KEGG   Homo sapiens (human): 1440Help
Entry
1440              CDS       T01001                                 

Gene name
CSF3, C17orf33, CSF3OS, GCSF, G-CSF
Definition
(RefSeq) colony stimulating factor 3
  KO
K05423  granulocyte colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04657  IL-17 signaling pathway
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1440 (CSF3)
   04151 PI3K-Akt signaling pathway
    1440 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1440 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1440 (CSF3)
   04657 IL-17 signaling pathway
    1440 (CSF3)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    1440 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1440 (CSF3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1440 (CSF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCSF IL11 NAGLU Img2
Motif
Other DBs
NCBI-GeneID: 1440
NCBI-ProteinID: NP_000750
OMIM: 138970
HGNC: 2438
Ensembl: ENSG00000108342
Vega: OTTHUMG00000133247
Pharos: P09919(Tbio)
UniProt: P09919 Q8N4W3
Structure
PDB: 

Position
17q21.1
AA seq 207 aa AA seqDB search
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctggacctgccacccagagccccatgaagctgatggccctgcagctgctgctgtgg
cacagtgcactctggacagtgcaggaagccacccccctgggccctgccagctccctgccc
cagagcttcctgctcaagtgcttagagcaagtgaggaagatccagggcgatggcgcagcg
ctccaggagaagctggtgagtgagtgtgccacctacaagctgtgccaccccgaggagctg
gtgctgctcggacactctctgggcatcccctgggctcccctgagcagctgccccagccag
gccctgcagctggcaggctgcttgagccaactccatagcggccttttcctctaccagggg
ctcctgcaggccctggaagggatctcccccgagttgggtcccaccttggacacactgcag
ctggacgtcgccgactttgccaccaccatctggcagcagatggaagaactgggaatggcc
cctgccctgcagcccacccagggtgccatgccggccttcgcctctgctttccagcgccgg
gcaggaggggtcctggttgcctcccatctgcagagcttcctggaggtgtcgtaccgcgtt
ctacgccaccttgcccagccctga

DBGET integrated database retrieval system