KEGG   Homo sapiens (human): 144100Help
Entry
144100            CDS       T01001                                 

Gene name
PLEKHA7
Definition
(RefSeq) pleckstrin homology domain containing A7
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PH WW PH_11 PH_8 PH_9 PH_3 OGG_N
Motif
Other DBs
NCBI-GeneID: 144100
NCBI-ProteinID: NP_778228
OMIM: 612686
HGNC: 27049
Ensembl: ENSG00000166689
Vega: OTTHUMG00000165954
Pharos: Q6IQ23(Tbio)
UniProt: Q6IQ23
Position
11p15.2-p15.1
AA seq 1121 aa AA seqDB search
MAAATVGRDTLPEHWSYGVCRDGRVFFINDQLRCTTWLHPRTGEPVNSGHMIRSDLPRGW
EEGFTEEGASYFIDHNQQTTAFRHPVTGQFSPENSEFILQEEPNPHMSKQDRNQRPSSMV
SETSTAGTASTLEAKPGPKIIKSSSKVHSFGKRDQAIRRNPNVPVVVRGWLHKQDSSGMR
LWKRRWFVLADYCLFYYKDSREEAVLGSIPLPSYVISPVAPEDRISRKYSFKAVHTGMRA
LIYNSSTAGSQAEQSGMRTYYFSADTQEDMNAWVRAMNQAAQVLSRSSLKRDMEKVERQA
VPQANHTESCHECGRVGPGHTRDCPHRGHDDIVNFERQEQEGEQYRSQRDPLEGKRDRSK
ARSPYSPAEEDALFMDLPTGPRGQQAQPQRAEKNGMLPASYGPGEQNGTGGYQRAFPPRT
NPEKHSQRKSNLAQVEHWARAQKGDSRSLPLDQTLPRQGPGQSLSFPENYQTLPKSTRHP
SGGSSPPPRNLPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEWQQRQQFRHGSPTAP
ICLGSPEFTDQGRSRSMLEVPRSISVPPSPSDIPPPGPPRVFPPRRPHTPAERVTVKPPD
QRRSVDISLGDSPRRARGHAVKNSSHVDRRSMPSMGYMTHTVSAPSLHGKSADDTYLQLK
KDLEYLDLKMTGRDLLKDRSLKPVKIAESDTDVKLSIFCEQDRVLQDLEDKIRALKENKD
QLESVLEVLHRQMEQYRDQPQHLEKIAYQQKLLQEDLVHIRAELSRESTEMENAWNEYLK
LENDVEQLKQTLQEQHRRAFFFQEKSQIQKDLWRIEDVTAGLSANKENFRILVESVKNPE
RKTVPLFPHPPVPSLSTSESKPPPQPSPPTSPVRTPLEVRLFPQLQTYVPYRPHPPQLRK
VTSPLQSPTKAKPKVEDEAPPRPPLPELYSPEDQPPAVPPLPREATIIRHTSVRGLKRQS
DERKRDRELGQCVNGDSRVELRSYVSEPELATLSGDMAQPSLGLVGPESRYQTLPGRGLS
GSTSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKSALERLYSGDHQRGKMSAEEQLERM
KRHQKALVRERKRTLGQGERTGLPSSRYLSRPLPGDLGSVC
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgacggtcgggcgggacactttacctgagcattggtcctacggggtgtgc
cgggatggccgcgtcttcttcatcaatgaccagctccgctgcacgacctggctgcatccg
cgcaccggggagcccgtcaactcgggccacatgatccgctcagacctgccccgcggctgg
gaggagggcttcacggaggagggcgccagctacttcatcgaccataaccagcagaccaca
gcattcaggcatcctgtgacgggacagttttctccagaaaatagtgaattcattcttcaa
gaagagccgaatccacatatgtcgaagcaagacagaaaccaaagaccgtccagcatggtc
agtgaaacatccacggctgggaccgcctccaccctggaggccaagcctggacccaagatc
ataaagtccagcagtaaagtccacagctttgggaagagagaccaggccattcggaggaac
cccaatgttcccgtggtggtgaggggctggctgcacaagcaggacagttctgggatgagg
ctgtggaaaaggaggtggtttgtgcttgctgattactgcttattttactataaagacagc
cgagaagaagcggtcctcgggagcatccccttgcccagctacgtgatctctcctgtggcc
cctgaggatcgcataagccgcaaatattcctttaaggctgtgcacacggggatgcgagcg
ctcatctataacagctccacagcgggctctcaggccgagcagtcaggcatgaggacctac
tacttcagtgccgacacccaggaggacatgaacgcttgggtcagggccatgaaccaggct
gcacaggtgctgtctcgatcgtcactgaagagggatatggagaaggtggagcggcaggct
gtcccccaggccaaccacacagagtcctgtcacgaatgtggccgggtgggacccggacat
acgagagattgtcctcatcgtggccatgatgacattgtcaacttcgagaggcaggagcag
gagggagagcagtaccgttcccagagggacccactggagggcaagcgggaccggagcaag
gccaggtctccgtactcgccagccgaggaggatgccttgtttatggatttacccactggc
ccaagaggccagcaggcacagccccaacgggcagagaagaatggaatgctgcctgcctca
tatggcccaggagaacagaatgggactggtgggtaccagcgggcctttcctcccaggacc
aaccctgaaaaacacagccaaaggaagagcaatctggcccaggtggagcactgggcaagg
gcccagaaaggggatagcaggagtcttcccttggaccagacgcttcctcgccagggtcct
ggccaatccctgtccttcccagaaaactaccagactcttcccaagagcacccgacacccc
tcggggggctcctcgccacctccccgaaacctgccaagtgactacaagtatgcgcaggac
cgagccagccacctgaagatgtcgagtgaagagcgccgggcgcaccgggatggcaccgtg
tggcagctctacgagtggcagcagcgccagcagttccggcacggcagccccacagcgccc
atctgccttggctccccagagttcaccgaccagggccggagcaggagcatgctagaggtg
ccccgctccatctctgtgcctccatctccctcggacatccctcccccaggacccccaagg
gtcttcccaccccggcggccacacacaccagcagagcgagtcacagtgaagccaccggac
cagaggaggagtgtggacatctcgctgggggattctccaaggagggcacggggccacgct
gtcaagaactcatctcatgtggaccgacgctccatgccctccatgggttacatgacccac
accgtcagcgctcccagtttacatggaaaatcggctgatgatacctacctccagctgaag
aaagacctggagtacctggatctaaagatgacaggccgggaccttctcaaggatcgaagt
ctgaagcctgtgaagatcgctgagagcgacactgacgtcaaactgagcatcttctgtgaa
caagacagggtcctccaggacttggaagacaagatacgagcccttaaagagaacaaagac
cagctagaatctgtgctggaggtgttgcacagacagatggagcagtaccgagaccagccc
cagcacttggagaagattgcctaccagcagaagttgctgcaggaggaccttgtccatatc
cgagctgagctctccagagagtccactgagatggaaaatgcttggaacgaatacctgaag
ttggagaatgatgtggaacagctgaagcagaccctgcaggagcaacacagaagagccttt
tttttccaggagaaatcgcagatacagaaagatctatggagaattgaagatgtcactgca
ggcctgagtgcaaataaagagaacttcagaattctagtggagtcagtaaaaaatccggag
agaaaaacggtgcctttgtttcctcacccgcctgtgccttcactctcaacttctgagagc
aagccgcccccacagcccagtcctcccaccagccctgtgcggacccctctggaggttcga
ctcttcccccagctgcaaacctacgtgccgtaccgacctcacccaccccagctgaggaaa
gtgacatccccccttcagtcaccaactaaggcgaagcccaaagttgaagatgaagcacct
cccaggcccccactccccgaactctacagcccagaggaccagcccccggctgtgccgcct
ctgccaagagaggccaccatcatccggcacacatctgtgcggggcctcaagcggcagtca
gacgagaggaagcgagaccgggagctggggcagtgtgtgaatggggattccagggtggag
ctgcggtcgtatgtcagtgagcctgagctggcgaccctcagcggggacatggcccagccc
tccctaggacttgtgggccctgagagcaggtaccagacgctgccaggcagagggctctca
gggtccacgtcaaggctccagcagtcgtccaccattgctccctacgtcacactccggagg
ggtctcaatgccgaaagcagcaaggcgaccttccctagacctaagagtgccttggagcgc
ctgtactcaggggatcaccagcgaggcaagatgagtgcagaggagcagctggagcgcatg
aagcgacaccagaaggccctggtccgagagcgcaagaggacactgggccaaggggagagg
acgggcctgccctcatctcgctacctcagccggccgctccctggagatcttggctcagta
tgttag

DBGET integrated database retrieval system