KEGG   Homo sapiens (human): 144132Help
Entry
144132            CDS       T01001                                 

Gene name
DNHD1, C11orf47, CCDC35, DHCD1, DNHD1L
Definition
(RefSeq) dynein heavy chain domain 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DHC_N2 Dynein_C AAA_6 AAA_8 AAA_7 Dynein_heavy MT Dynein_AAA_lid AAA_9 AAA_5 AAA_16 AAA_lid_1 AAA_22 T2SSE AAA_lid_11 DDHD Presenilin
Motif
Other DBs
NCBI-GeneID: 144132
NCBI-ProteinID: NP_653267
OMIM: 617277
HGNC: 26532
Ensembl: ENSG00000179532
Vega: OTTHUMG00000133403
Pharos: Q96M86(Tdark)
UniProt: Q96M86 B0I1S4
Position
11p15.4
AA seq 4753 aa AA seqDB search
MVPEERRVGLSSDETSSDSLKSWHSICVLDSKEQPLACQQKQRQFVKPVTESEQPTVLEL
LLAELRTLFSAVLQDSSPAAWRYLHAVLGLLPPYRELLVGHLDLLPFLEQLYCWAPWVQT
HLHLDLLGAIVQAFPPDSSLLDSASHADCCPQKRRLHHRPPCPACPFVQAQWSRQQVKEE
LATWLRPLTLPELQRCLGIVGAQVALEEAVWLDGLSLLPLALAADIPVRYESSDTDNAEV
EPVGRKETRSQLDYEVPREKAFQKSSTGFSPETSFLDSQVMTALKMERYLKKIHFLYLNV
APSRYFRPYSLMVVPPDKVNPEHYIFSPFGILHVHPVEGSETMTLGTWHHHCVLWQQLQF
IPFFKYCLLRKSFTCWKKNVRLQGLHRLQKFLENHLLLAVPHFGAGLLHISRLLQELHSV
SWLPQELDRCYELLDLQTALAEEKHKALRLLHRCLNLCTSILRLVHEDTYHMQQCLQERV
QNCDRIRTGQGSIYLQRVQHKQLEQKLKQAEAWWLQLGKFARLVDYMICQSLISVLEEQI
TSFVANILQAPRQKPFLSSQLVFDDHGQLSHVPCVENMIQTLTGGLQSVKTSALQVVQSA
DLKTSSDSLYSEEEDEEEDSKDEFLMPKFQGQPSDAVSIFCGPNVGLVWPWKSHPIAGIL
EVRGCRLRGQYFPHNYKQLEEDLDNNPKIQQALNIQQVLLEGVLCKVQEFCREHHWITGI
YEFLQSWGPQKLEDMRGGPIKNYVTLVSRLNVWQARVSSMPIELLTKGGLLLLSCHDVQA
EMESKLNSIRKDILAHVQNECWNLSQQLMTELTDFMHIFRTINSDIHAIAQCTQKLNEAN
EQYVELEERMEYVRALHELIRNHFSLFSAENEALDISVRRQFGESPIPPCPPPPQPHLLH
CPLLAPQLLDMWEAFQFEKSQASEFLLSKRHAIMPKLQQLMAAALAELEGLLAKALSGPF
MDPTQDQRSTEHQLVSLERQFQNTVSDLSELHHAYAIFTEDETPVPLPICGTRPIVQQQR
IWHLYRVISENISEWKCMAFAKFSPAMAQEKTEGWLTEAARMSTTLELHSPVLQHCMRIL
GEFRSYLPLLTKLGSLHPQSLNCQCLLRALGLGSLQTIELLTLGQLLTYPLLEFADRINQ
VWQNENERIHAQETIRRLQRYWEARQLRLLNFILHVPYEPPASERSKRQVLRSPQWEVVD
KDSGTFILSDYSNLQDSIQESLQVLSKILAIEKSGDLNKIALEWVAIMHGLGALLEVWLT
FQQKWIFLNKVLHEMKIQFPNADLNSRFKVMDDQYRTLMRISVADPMVLSLVVPSAERSP
YFQGQQLQQLLQAGSVELEGIIMSLESVLYGVCAHFPRLFFLSDSELVALLAARLESCEA
QLWVRRCFPHVHAVSFRSCPTGEKNTDDWESSPNTQTQVEALAVLGAGGEEVKLQGPLPL
HPDLPKWLASLEKCLRLALVHMLQGCVAARLARGPSLGEALKQLPKQNKLYLQLYVQHWI
DLVQAFPWQCVLVAEEVVWRAEMEEALLEWGTLAMVSMHMRKLEVLVNFMRAQRASQGGQ
SLPSVRQTSLLSALLVMAVTHRDIAQLLEQHQVSDLTDFHWVRQLKYHLGSPHIIPKSPL
QSLKTIASSEPSLSPAACWIDVLGRSFLYNYEYLGPRLGPLPSLLPERPALVLLLALEEV
ACGTVLGPNGVGKRAIVNSLAQALGRQLVMLPCSPQIEAQCLSNYLNGALQGGAWLLLEK
VHQLPPGLLSALGQRLGELHHLYAPLYQEASRNTSTIDPTQPQLLGSSFFEKHHVSVRLG
YGCLLVLRALSSAVPANLHLLLRPVALALPDLRQVAELTLLGAGMRDAFQMATRLSKFFS
LERELVSGPLPCRLPLLKQILEDTIRTLNVTKEEPKCQKPRSLAAIEEAALLRSPLFSIL
NGLHLHNLRGLLCALFPSASQVLAEPMTYKLMKPLVVEELQQVGLDPSPDILGSLEQLSQ
ALSRASGILLLGPAGSGKTTCWHSLFKIQNRLAAMEDTSTQGCQPVEITHLYPSGLSPQE
FLGWLEGSCWHHGIFPKVLRAAGQCNNMGQKRQTEESIGIQHWIICDGASNGAWLDSITC
LLSELPQLSLPSGQQIARPPGTFLLMEVADTTGISPTVVGCCALVWCGGEQTWQCILSAL
MASLPYEYRLQHRTVAELNHMAEVLVPATLRFLTCQGVSSLLQVHGQQAVCAGVAEVTSM
ARILHSLLDLHLRLKEEKAPGPEDLSYSDPVAQSFRSSKSSFLNRSQVDSDDVPDKCREH
LLAVSSFLFALIWGFGAHLPSRFWPIFDTFIRDSISRLSNYPEPPPSALVFDLHVSPEDG
TLVPFTGQYLSSHIKGTLGTFHPSIQTERLLYVVDLLLSGGQPVLLAGEAATGKSAFVEV
LVEPHHPYIYSPIHPAFSSSHLRLLLSRGIQGQTQASPQPGHHQDSKPSLLFLLEDLHLA
TSDPEKSCQPVLETLRQAMDGTVYAHSTLELQTLQPTVNFLATVTVPGYCERPLCPRLFR
LFTVLALESMTQATLLERHVPIIQAWLERFPSVERERALARGLVRASVEAWEAVCNCFMP
SPLHPHYHFSLHSVSHLLSSLQLLPNRTGSRGFVDYPNHQEHLRRVSGLRGTCLTVMMAT
RNVVRLWLHEAQRTFCDRLDSPRERSYCAKLLLVVAQSVFCCGPGPQHLGKDHQESEEEE
EEERVPEVESEGELAQWEDFSNSNSETEEEEEPYGLQVARVSNSRDPSLTPSIGPVSRGM
KESISHKIRQEKGTRASNYRLQVRRSFKTWWQKKPQMDLISPLLLPVLLLHPQEKPSDLV
FSQELILGPNSETPNLYLERQWEKLEEQLATSAAQLKLSPHLARCHSMAQHVARLVRVLA
RPRQHGLLLSGALGTGRHTAITLASSICQAHFFHLPSGSEEAILQCLRDASWHAGMLSQP
VALLVPSGVDLTTLHRLLALATSGSFPGQYTEADLDRIGEHLPRENLGVKQNIKKEMVLQ
RFHQQVCSHLHLFFLIGDKQAHKQLPSTLFLRLLQLATASIDRYEPWDQAALAKVAQHHL
EGAQSVPLDDGSWKYPDLQASIPSVAKAMALIHLSATHYHEHLCPALPLVTPKTFLDFLD
TFLMLQQQTILKIKNKAQRVQNALENLRMLIKEHGTHANLIFDLEQQLKDSGKSLSMFQQ
QLEQSKLLYKQQLEECRHQENLIENLARQRDALQAQREAFLEQMSKAFLEPLSQLQVADF
EEIRSYRAPPESVVRVTDAMCDLFHHETGWASAKQLLCTEDFYQELVFFPKEKITDSELI
KLHLILKAPGMDDAALRAVSRPAASLAAWLWAVLHYGLAHCRGLPTDLLLQQVEATLTRE
QARLGYYQFQAQETLEHNLALAKMVEDAQASHNCVAKTLSQAQCGQYHKWPMKAALLTPM
RAWTTQLQKLKGRCMTVFGDTLLCSAAIIYLGPFPPLRRQELLDEWLALCRGFQEALGPD
DVAQALKRKQKSVSIPPKNPLLATHSPFSILSLLSSESEQYQWDGNLKPQAKSAHLAGLL
LRSPTHYSSCRWPLLLDPSNEALIWLDPLPLEENRSFAPALTEGRGKGLMRNQKRESKTD
MKEEDDESEESNEAEDQTKEQKAEERKNEQEKEQEENEEKEEEKTESQGSKPAYETQLPS
LPYLSVLSGADPELGSQLQEAAACGLPVLLTNVELGLGCEELQWLLQREQLSPPQVQPGF
CLYLSTTLSLCAMEKVLGCELLKGLNVLDLGLNMEILEEQMLHEILCREYPELETRWQDL
KIRALDTCKAVEAAEERLLTMLLFQNPKRQKPAKFLRNIVRAQGKLCQLRAHCEELEGQK
LQEMVLWAPYRPVVWHGMAMVKALSQLQNLLPLFCMSPENWLAVTKQALDSMKPREINHG
EDLASHLLQLRAHLTRQLLGSTVTALGLTQVPLVGALGALALLQATGKASELERLALWPG
LAASPSTVHSKPVSDVARPAWLGPKAWHECEMLELLPPFVGLCASLAGHSSAWQAYLSLS
STVLGPAPGPGPEPLSLLQKLILWRVLRPECLAGALADFTTSLLGRPLDENTYAPTMPFK
HSQATQPMLILLPPPGHPSATLHPLTVIQKLAAKYQQGQKQLQVIALGSEAWDPVSVVVS
TLSQAMYEGHWLVLDNCHLMPHWPKELLQLLLELLGRAKVVADLESEQLLDQPESRNVST
VHRDFRLWLIVPAESSASLPAVLTQHSMPVFWNQSLELGHVLIDSVELAQQVLYMQPPTQ
ALPLLLLHGLLLHRQLYGTRLQAHRGRWSQVTLTQVLQTQDQLWASLSNPRAAMQELAAS
VFYGGPLGDTEDREALISLTQACLSPSSGSWVQPHTPQSLLATLMPLPELRELDAMAECK
AQMHLLPSPPEPRLCGLSEGPQAWLLRRQSRALLSALQRSSPVWVPESRRGAQLAERRLR
QRLVQVNRRLESLQDLLTHVIRQDESDAPWSVLGPNARRPLEGVLETEALELSQLVGTLQ
RDLDCLLQQLKGAPPCPSRRCAAVAHALWTGRLPLPWRPHAPAGPQPPWHWLRQLSRRGQ
LLVRYLGVGADASSDVPERVFHLSAFRHPRRLLLALRGEAALDQNVPSSNFPGSRGSVSS
QLQYKRLEMNSNPLHFRVENGPNPTVPERGLLLIGLQVLHAEWDPIAGALQDSPSSQPSP
LPPVSISTQAPGTSDLPAPADLTVYSCPVYMGGPLGTAKLQSRNIVMHLPLPTKLTPNTC
VQRRVHVCSPPLS
NT seq 14262 nt NT seq  +upstreamnt  +downstreamnt
atggtcccggaggagaggagggtaggtttgtcttctgatgagacatcatctgattccctt
aagtcttggcactccatatgtgtcttggacagcaaagaacagcccttggcctgccagcag
aaacagaggcagttcgtgaagccagtgactgagtcagagcagcccacagtgctggaactc
ctgctagctgagctccgaactctgttctcagctgtgttgcaggacagtagccctgcagct
tggcgctatcttcatgcagtactgggtctactgcctccatatcgtgagttgctagttggc
caccttgatttgctgcccttcctggagcagctgtactgctgggcaccctgggtccaaacc
cacctccatctggacctgctaggtgccattgtccaggcctttcctccagacagctctttg
ttagacagtgcttcccatgctgactgctgtccccagaagcggaggctccatcacaggccc
ccatgcccagcttgcccttttgtgcaggcccagtggagcaggcagcaagtaaaggaggag
ctggccacctggctgcgaccattgacactgcctgagctacagcgctgcctgggcattgtt
ggtgctcaggtggccctagaagaggctgtgtggctggatggacttagtctccttcccttg
gcactggcagcggacatccctgtacggtatgaaagcagtgacactgacaatgcagaggtg
gagcctgttggaagaaaagagaccaggtctcagcttgactatgaagttcccagggaaaag
gccttccaaaagagcagcaccggcttttcacctgagacttccttcctggatagccaggtg
atgactgctctgaagatggagagatacctgaagaagatccacttcctctatctcaatgtg
gctcccagccggtactttaggccttacagcctgatggtggtgccacccgacaaggtgaat
cccgagcactacatcttctctccctttgggatcttgcatgtacatcctgtggaaggtagc
gagacgatgacactgggtacctggcaccatcactgtgttctctggcagcagctccagttc
attccattctttaagtattgcctcttacgcaagtcctttacctgttggaagaagaatgtg
agattacaggggctgcatcgactccagaaattcctagagaatcatctgctcttggctgtg
ccccactttggagctgggctactccatattagcaggcttctgcaggagctacactctgtg
tcctggctaccccaggaactggatcggtgctatgagctgctggacctgcagacggctcta
gccgaggagaagcataaggctctacggctgctccatcgttgcctaaacctctgcacatcc
attcttcgactggttcacgaggacacataccacatgcaacagtgcctacaggagcgagta
caaaactgtgacaggatcaggacaggccaaggctccatataccttcagagggtacagcac
aagcaactggagcagaagctgaagcaagcagaggcctggtggctgcagctgggaaagttt
gcccgcctggttgactacatgatttgtcagagcctcatttctgtcttggaagagcagata
acctcttttgtggccaacatccttcaagccccaaggcagaaaccctttctctcatcacag
ctggtctttgatgatcatggtcaactgtctcatgtgccctgtgttgaaaatatgatccag
actctaactggaggcctacagtctgtcaagacctctgccttgcaggtagtgcagtctgca
gacctgaagacctcctcggattccctgtattctgaagaagaagatgaagaggaggactca
aaagacgaatttctgatgcccaagttccagggccagcccagcgatgctgtgagcatcttc
tgtggcccgaatgtgggattggtgtggccctggaagtctcacccaattgctggtatcttg
gaggtccgtggatgtcggctgcggggccaatacttcccccacaattataagcagctggag
gaagacctggacaacaaccctaagatccagcaggcactgaatatacaacaggtgctgctg
gagggcgtgctgtgcaaggtgcaggaattctgcagggaacatcattggataacaggcatt
tatgaattcctgcaatcctgggggcctcagaagctggaagacatgagaggtggtcccatc
aagaactacgtgacgctggtgagccgcctgaatgtttggcaggcccgtgtctccagtatg
cctatcgagttgctcacaaaaggcgggttgctgctacttagctgccatgatgtacaggca
gagatggaatccaagctgaacagcataaggaaggacattcttgcacacgtgcaaaatgag
tgctggaacctcagtcaacaactcatgacagagctcacagatttcatgcatatcttccga
accatcaactcagatattcatgccattgcacagtgcacccagaagttgaatgaagccaat
gaacagtacgtcgagctggaggagcgaatggaatacgtacgggcactccacgaactcatc
cgcaaccactttagcctctttagtgctgagaatgaagcactggacatctcggtgagaagg
caattcggggagtcacccatccctccctgccctcctcccccacaaccacatctactccac
tgccctctgcttgccccacagcttctggatatgtgggaggcatttcagtttgagaaaagc
caggcttcagagttcctgctcagcaagcgacatgccattatgcccaagctgcagcagctg
atggcagcagcattggcagagctggaaggcctgcttgcgaaggccctctccggtcccttt
atggaccccacacaagatcagaggagtactgagcaccagctcgtctccctagagcgtcag
ttccagaacacagtcagcgacctcagtgaactgcaccacgcctatgccatcttcactgag
gatgagactcctgtgcccttgccaatctgtgggacacgtcctattgtgcagcagcagcgc
atatggcacctgtaccgagtcatctccgaaaacatcagcgagtggaagtgcatggctttt
gccaagttcagcccagctatggcccaggagaagacagagggctggctgacagaggcagca
cggatgagcacaaccctggagctgcacagccccgtgctgcagcactgcatgcgcatcctg
ggggagtttcgcagctacctgcccctgctcactaagctgggcagcctccacccacagagc
ctcaactgccagtgtctcctgcgtgcccttgggctgggcagtctccaaactatagaactc
ctaacgctgggccagctgcttacttatccactgctggagtttgcagatcgaatcaaccag
gtctggcagaatgaaaatgaacgaattcatgcccaagagactatacggcggttgcagcgg
tactgggaagcgcgccagctgcgcctgctcaacttcatcctgcatgtaccctacgagccc
ccagcctcagagcgctccaagaggcaggtgctccgcagcccccaatgggaggtagtggac
aaagatagtggcaccttcatcctctcagattacagcaacctgcaggattccatccaggaa
agtcttcaggtgttgtccaagatcttggccatcgaaaagtcaggagatttaaacaaaata
gctttggagtgggtggccatcatgcatggcctgggtgccctgctggaggtgtggctgact
ttccagcagaagtggatttttctgaataaagttctgcatgagatgaagatccagtttcct
aatgctgacctgaactctcgtttcaaggtcatggatgaccagtatcgaaccctgatgcgc
atctctgtagctgaccccatggttctgtcacttgtagtgcccagtgccgagaggagccct
tacttccaaggccagcagctgcaacaactgctgcaagcaggatcggtggagctggagggc
atcatcatgagtctggagagcgtgctctatggggtgtgtgctcacttcccccgcctcttc
ttccttagtgacagtgagctggtagccctgctggctgctcgactggaatcatgcgaagcc
cagctatgggtacgacgctgctttcctcatgtgcatgctgtgagcttcaggtcttgccca
actggtgagaaaaacacagatgactgggagtcaagcccaaacacacagactcaggtggag
gcacttgcagtgctaggggcaggtggggaggaggtgaagctgcagggtccccttcctctg
catccagatctccctaagtggctggcctctctggagaagtgtctgcgcttggcactggtg
cacatgctgcagggctgtgtggctgctcgccttgctcgaggcccatctctaggtgaggcc
ctcaagcaactgcccaagcaaaacaagttgtacctgcaactgtatgtccagcactggatc
gacttagtccaggccttcccatggcagtgtgtgctggtggcagaggaggtggtatggcgg
gccgagatggaggaggctctgcttgagtggggtaccctggccatggtctccatgcatatg
cgcaagcttgaggtactggtgaattttatgcgggcccagagggcttcccaaggtgggcag
tccctgccttctgtccgccagaccagccttctcagtgccctgctggtcatggcagtgact
caccgggatatagcacagctgctggaacagcaccaggtcagtgatctcacagactttcac
tgggtccgccaactcaagtatcacttgggttcacctcacataatccccaaaagcccccta
cagagtcttaagactattgcatcttctgaaccctctctgtcaccagcggcatgctggata
gatgtgctaggcaggtccttcctgtacaattacgagtatctgggacctagactagggcct
ctacccagcctactgcctgaacggccagccctggtactattattggccctagaggaggtg
gcctgtgggaccgtactgggtcctaatggtgtgggcaagagagctatagtgaacagcctg
gcacaggccctgggccgccagctggtgatgctaccctgctcacctcagatagaggctcaa
tgcctgagcaactatctgaatggtgccctgcagggtggtgcctggctgctgttggagaaa
gttcatcagctgccccctggcttgctctctgccctgggccagcgcctgggtgaactgcac
cacttgtatgccccactgtaccaggaggcttcccgaaacacaagcaccatagaccccacc
cagccccagctccttggcagtagcttctttgaaaaacatcacgtgtctgtgcgccttggc
tatggctgtctcctggtactgcgtgccctgagctctgctgtgcctgccaacctgcacctg
ctgctgcggcctgtggcattggcattgcctgatctgcggcaagtggcagagctgactctg
ctgggtgcagggatgagggatgccttccagatggctacccgcctatccaaattcttctct
ctagagcgtgagctggtgtctgggcccctgccctgccgcctgccactgctcaagcagata
ctggaagacacaatacggacactaaatgtgaccaaggaggaaccgaagtgccagaagcct
cgcagcctagctgccattgaggaggctgccctactgcgctcaccactgtttagcattctc
aatgggctccacctgcacaacctccgagggctgttgtgtgcgcttttccctagcgccagc
caagtgctggcagaacctatgacttacaagctgatgaagccattggtggtggaggaactg
caacaggtaggtctggatcccagccctgacattttggggtccttggaacagttgagccag
gccctgagccgggcctcaggcattctgctcctgggccctgcgggcagcggcaagaccact
tgttggcacagcttatttaagatccagaatcggctggcagccatggaggacacctcaacc
caaggctgccagcctgtggaaattacccacctgtaccccagtggcctcagcccccaggag
ttcctgggatggctagagggctcctgctggcatcatggcatctttcccaaggtacttcgt
gcagccggtcagtgtaacaacatgggccaaaagaggcagacagaggaatcaatcgggatc
cagcactggataatatgtgatggagcctccaatggtgcttggctggactccatcacttgc
ctcctgagtgagcttccccagcttagtctccccagtggacagcagatagcacgaccccca
ggcacctttctcttgatggaggtggctgacacaacaggcatatcccccacagtggtaggc
tgttgtgccctagtctggtgtggtggagagcagacttggcagtgtatacttagtgccctg
atggcatcccttccttatgagtaccgcctgcagcaccggacagtcgctgagctcaaccac
atggctgaggttctggtgcctgcaacattgcgattcctcacctgccaaggtgtcagctct
ctgctgcaggtacacgggcagcaggctgtttgtgcaggtgtggcagaagttaccagcatg
gcacgcatcttgcatagtctgcttgacctccaccttcgcctaaaggaggagaaggcccct
ggcccagaggacctcagctatagtgatcctgtggcccaaagcttcaggtcttcaaaaagc
agctttctaaaccggtcccaggttgacagtgacgatgtgccagataagtgcagggaacac
ttgctggctgtcagcagttttctttttgccttgatctggggctttggagcccaccttccc
tccaggttctggcccatctttgataccttcataagggattctattagtcgcctctccaac
taccctgagccaccaccctcagccttggtgtttgatctacatgtaagccctgaagatgga
acactggtccccttcactggccaatacctgagcagccacatcaaaggaactttgggcacc
tttcacccttctatccagactgaacggctcttgtatgtggtggacctgcttctgtcaggg
ggacagccagtgttgctggctggagaggcagcaacagggaagtcagcctttgtggaggtg
ctggtagagccacatcacccttacatatacagccccatccaccctgccttcagttcctcc
cacctccgtctcctgctgagcagaggaatccagggccaaacacaagccagcccacagcct
gggcatcaccaggattctaaaccctccctcctcttcttgctggaggacctgcacctagcc
acttctgacccagagaagagctgccagccagtgttggagactctgcgccaggccatggat
ggcactgtgtatgcccacagcaccttggaactgcagacgctgcagcctacagtcaacttc
cttgccactgtcacagtgccaggatactgtgagcgcccactgtgtccacgcctctttcga
ctcttcacagtcctggccctggaaagcatgacccaggccaccctgctggaaagacatgtg
cctatcattcaggcttggcttgagcgtttcccttctgtggaacgggagcgtgctctggca
cgaggtctggttagggcctcagtagaggcctgggaggctgtgtgcaattgcttcatgcct
tcacccctccacccacactaccacttctccctacactctgtgagccacctactgagcagc
ctgcagctgctgcccaacagaacaggctcccgaggttttgtggactatcccaaccaccag
gagcacttgcgccgggtgtcaggcctgcgaggcacttgtctgaccgttatgatggccaca
cgcaatgtggtgcgtctttggttgcatgaggcacagagaaccttttgcgaccggctggac
agccccagggaacgctcctactgtgccaagctgctcctagtagtagctcaaagtgtcttc
tgctgtgggccagggccccagcacctgggcaaggaccatcaggagagtgaggaggaggag
gaggaggagagggtgcccgaagtagaatctgaaggggagttggcccagtgggaggacttc
agcaacagcaatagtgaaacagaggaggaagaggaaccttatggccttcaggtcgccaga
gtctcaaactccagagatccaagtctaacaccatccataggaccagtaagcagggggatg
aaggaaagcataagtcacaagataaggcaagagaaaggcacaagggcatccaactatagg
ctccaggtaaggagatcattcaagacttggtggcagaagaaaccccagatggacctgatc
tcacccttgttgttaccagtgttactactacatccccaggaaaagccctcagacctggtc
ttcagtcaggagctgatactggggcctaactctgagacccccaacttgtacctggaacga
cagtgggagaagctagaggagcagttggccacctcagctgctcaactgaagttgagcccc
cacctggcccggtgtcattccatggcccagcacgtggcccgcctggtccgggtgctggcc
aggccccggcagcatggcctgctgctctcgggggctctgggtactgggcgccacactgcc
atcactctggcttctagcatttgtcaggcccatttctttcatctaccatctgggtcagag
gaggccattctccaatgtctacgagatgccagctggcatgctggcatgttaagccagcca
gtggctctgttggtacccagtggtgtggatctcactacacttcatcgcctcctggccctg
gcaacctcaggcagtttccctggccagtacacagaagcagatttggaccgcattggagaa
cacctccccagggagaaccttggtgtcaaacagaacatcaagaaggaaatggtgttgcag
aggttccaccagcaagtgtgcagccaccttcacctgttcttcctgattggagataaacag
gcccacaagcagctgccctccacccttttcctgaggctccttcaactggccactgccagc
attgaccgctatgaaccctgggaccaagctgccctggccaaggtggcccagcatcacctg
gagggtgctcagagtgtgccccttgatgacggctcctggaagtacccagacctccaggcc
tcaattcccagtgtggccaaagccatggctcttatccacctttcggccacccactaccat
gagcacctgtgccctgcattgccactcgtcacccccaagaccttcctagacttcctggac
actttcctgatgctgcagcaacagacaatcctgaagattaagaacaaggcccagcgggtc
cagaatgccttggagaatctgagaatgctgattaaggagcacggtacccatgccaatctg
atctttgacttggaacagcagctgaaagactccggcaagagtctcagcatgtttcagcag
cagctagagcaaagcaagctcctatacaagcagcagctggaagagtgtcggcatcaagag
aacctcattgagaacctggccaggcaacgggatgccctgcaagctcagcgagaggctttc
ctggagcagatgagcaaggcatttctggagcctctgagccagctgcaggtggctgacttt
gaggagatacggagctatcgagcaccaccagaatctgtggtccgggtaactgatgcaatg
tgtgacttgttccaccatgaaacaggctgggccagtgccaaacagctgttatgcactgag
gatttttatcaggagctggtgttcttccccaaggagaagataacagactcagagctgata
aagttacatctaattctgaaggctccaggtatggacgatgcagccctgcgggcagtgagc
cgacctgcagccagcctggcagcctggctctgggctgttctgcactatgggctggcgcat
tgccggggactgcccacggacctgctgctgcagcaagtggaggcaacactcactcgggag
caggcccgcctgggctactaccagtttcaggcccaggagaccctggagcataatttggcc
ctggctaagatggtggaggatgcccaagcttcccacaactgcgtggcaaagaccctcagt
caagcacagtgtgggcagtatcacaaatggcccatgaaggctgcactgctcacgcctatg
cgtgcctggactacacagctccagaagctgaagggacgctgcatgactgtgtttggagat
accctcctatgttcagctgccatcatctacctgggtcccttcccaccattgcggcgccaa
gagctactggacgagtggttagctctgtgtaggggctttcaggaggctctgggcccagat
gatgtggcacaggcactgaagcggaagcaaaaatctgtcagcataccaccaaagaacccc
ctgctggctacacactctcccttcagtattctgtccttgctgagctctgaatcggagcag
taccagtgggatggaaacctgaagccacaggcaaagtcggcccacctggcaggcttgctt
ctgcgaagccccacacactacagtagttgccgttggcctctgctgcttgaccccagcaac
gaggccctcatctggttggacccgctgcctctggaagagaatcgatcttttgcgccagcc
ctcactgagggtagagggaaaggcctcatgagaaatcaaaagagagagagtaaaacggac
atgaaagaggaagatgatgagagtgaagagagtaatgaggctgaggaccagacaaaagag
cagaaggcagaggaaagaaaaaatgagcaggagaaagagcaagaggaaaatgaagagaaa
gaggaggagaagacagagagccaggggtcaaagccagcctatgagactcagcttccatcc
cttccctaccttagtgttctttcaggtgctgacccagagctgggttctcagctccaggag
gcagctgcttgtggcctgcctgtgttactgaccaatgtggagctgggtctagggtgcgaa
gaactgcaatggctgctgcaacgggagcagctgagtccaccccaggtgcagcctggcttc
tgtctgtatctcagcaccaccctctccctctgtgccatggaaaaagtgctaggttgtgaa
ctgctaaaggggctgaatgtgttggatctgggcctgaacatggaaatactggaagaacag
atgctgcatgaaatcttgtgcagagagtatcctgaactcgagacccgctggcaggaccta
aagatcagagccctagatacctgcaaggctgtggaggctgctgaggagcggctgctgacg
atgctgctgttccagaatccgaagcgtcagaagccagccaagtttctgcggaacatagtg
agggcccaaggaaagctatgccagctgcgtgctcattgtgaagagttagaagggcagaaa
ctacaggagatggtattgtgggcaccctatcgacctgtggtttggcatggaatggccatg
gtaaaggccctaagccaactgcagaacctgctgccacttttctgtatgagcccagagaac
tggctggcagtcactaagcaggctctggacagcatgaagccacgtgagattaatcacggg
gaggacctggccagccatctactgcaattgagagcacacctgacccgccagctgctgggc
agcaccgtgactgcactgggccttacccaagtacccttggtgggtgcattgggcgctttg
gctctgctgcaagcaacagggaaagcatcagagctggaaagactggcactctggcctgga
ctagcagcctctcccagcacagtccacagcaagccagtctcagatgtggctcgaccggcc
tggcttgggccaaaagcctggcatgaatgtgagatgttagagctgctgcccccatttgtt
ggcctgtgtgcctccctggcaggccactccagtgcttggcaggcttacctgtcactgtca
tccacagtgctgggtcctgcacctgggccagggcctgagccactcagcctcctccagaag
ctgatcctgtggcgcgttctgcgacctgagtgcctggcaggtgccctggcagacttcacc
actagcctcctgggtcggcccctggatgaaaacacgtatgctcccaccatgccctttaaa
catagtcaggctactcagcccatgctgatcttgttgccaccgcctggccacccctcagcc
actctgcatcctctgactgtcatccagaaactggctgccaagtatcagcaggggcagaag
caactgcaggtgatagccctgggctctgaagcctgggacccagtctcagttgtggtcagc
actctatcccaggctatgtatgaggggcactggctggtgctggacaactgtcatctgatg
ccccattggccgaaagagctgctacagctcttgctggaactgttaggcagagccaaggtg
gttgcagacctggaatcagaacagcttttagaccaacctgaaagcaggaatgtaagcact
gttcacagagattttcgtctttggcttattgtgcctgcagagtctagtgcttctttgcca
gctgtgctgactcagcactccatgcctgttttctggaaccagtccctggagctgggccat
gttttgattgacagtgtggagctagcccagcaagtactctacatgcaaccccccacccag
gcactacctctgctcctcctccatggcctcctgctacaccggcagctctatggaacaagg
ctgcaggcacacagggggcgctggagtcaagtgactctaacccaggttcttcagacccaa
gaccagctgtgggcaagtcttagcaatccccgtgctgccatgcaagagctggctgcttca
gttttctacgggggtcctctgggggacactgaggacagggaggccctgattagcctcaca
caagcctgcctgagccccagtagtgggagctgggtccagccacacacacctcagtctttg
ctggccacgctcatgcccctcccagagctaagggagctggatgcaatggcagagtgcaag
gcccagatgcacctactgccctcaccacctgaaccccggctctgcggactgagtgagggc
ccccaagcctggctgttgcgacgccagagtcgcgctctcttgagtgcgctgcagcggagt
tcacccgtgtgggttcctgagtctcgaagaggcgcccagcttgcggaaaggcgactgcgg
caacgcctagtgcaagtcaaccggaggctggagtcactgcaggatctgctgacccacgtg
attcgccaagacgagtccgacgccccgtggtcagtgctggggccaaatgcacggcggcct
ctggagggcgtcttagagaccgaggctctagaactgagccagttggtgggcacgctacaa
cgcgaccttgattgcctgttgcagcagctgaagggcgcacccccgtgcccctcccgccgc
tgtgctgcggtggcccacgctctctggactggccgcctacccttgccttggcgacctcat
gcgccggccggtccgcagccgccctggcactggctgcgacagttgtcgcgccgtgggcaa
ctgttggttcgttacttgggcgtgggcgcggacgcgagcagtgatgtaccagagcgcgtc
ttccacctgtcagcctttcgccacccgcgccgcctgctgctggcattgcgtggggaagct
gccctggaccagaatgtgcccagctcgaatttccctggtagccgaggctcggtctccagt
cagctccagtataaacgtctggagatgaacagcaaccctctgcacttcagggtggagaat
ggtccaaatcccacggttccagagagagggctgctgctgatcgggctacaggtcctacat
gcggagtgggacccaatagctggagccttgcaggacagtccttccagccaacccagccct
ctgcctcccgtcagcatcagcacacaggccccgggcaccagtgacctgccagccccagcc
gacctgactgtgtactcgtgtcctgtgtacatgggagggccccttggcaccgctaagctg
cagagcaggaacatcgtgatgcatctgcctttacccaccaagctcacccccaacacctgt
gtccaaaggagggtccatgtgtgcagcccacccctgtcttga

DBGET integrated database retrieval system