KEGG   Homo sapiens (human): 144165
Entry
144165            CDS       T01001                                 

Symbol
PRICKLE1, EPM1B, RILP
Name
(RefSeq) prickle planar cell polarity protein 1
  KO
K04511  prickle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H00810  Progressive myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    144165 (PRICKLE1)
SSDB
Motif
Pfam: PET LIM Vasculin
Other DBs
NCBI-GeneID: 144165
NCBI-ProteinID: NP_001138353
OMIM: 608500
HGNC: 17019
Ensembl: ENSG00000139174
Vega: OTTHUMG00000169443
Pharos: Q96MT3(Tbio)
UniProt: Q96MT3 A0A024R0W7 B3KVG3
Position
12q12
AA seq 831 aa
MPLEMEPKMSKLAFGCQRSSTSDDDSGCALEEYAWVPPGLRPEQIQLYFACLPEEKVPYV
NSPGEKHRIKQLLYQLPPHDNEVRYCQSLSEEEKKELQVFSAQRKKEALGRGTIKLLSRA
VMHAVCEQCGLKINGGEVAVFASRAGPGVCWHPSCFVCFTCNELLVDLIYFYQDGKIHCG
RHHAELLKPRCSACDEIIFADECTEAEGRHWHMKHFCCLECETVLGGQRYIMKDGRPFCC
GCFESLYAEYCETCGEHIGVDHAQMTYDGQHWHATEACFSCAQCKASLLGCPFLPKQGQI
YCSKTCSLGEDVHASDSSDSAFQSARSRDSRRSVRMGKSSRSADQCRQSLLLSPALNYKF
PGLSGNADDTLSRKLDDLSLSRQGTSFASEEFWKGRVEQETPEDPEEWADHEDYMTQLLL
KFGDKSLFQPQPNEMDIRASEHWISDNMVKSKTELKQNNQSLASKKYQSDMYWAQSQDGL
GDSAYGSHPGPASSRRLQELELDHGASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSL
ALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNMGTLNSSMLHRSAESLKSLSS
ELCPEKILPEEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYDIEIRQPPMSERTRRRV
YNFEERGSRSHHHRRRRSRKSRSDNALNLVTERKYSPKDRLRLYTPDNYEKFIQNKSARE
IQAYIQNADLYGQYAHATSDYGLQNPGMNRFLGLYGEDDDSWCSSSSSSSDSEEEGYFLG
QPIPQPRPQRFAYYTDDLSSPPSALPTPQFGQRTTKSKKKKGHKGKNCIIS
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgcctttggagatggagcccaagatgagcaaactggcctttggctgtcagagaagttcc
acatcagatgatgactctggctgtgcattggaggagtacgcctgggtccccccgggcctg
agaccagagcagatccagctctattttgcttgcttaccagaggaaaaagttccttacgtt
aacagccccggagagaagcatcggattaaacagcttttgtaccagttaccaccacatgat
aatgaggtacggtattgccagtctttgagtgaagaggagaaaaaagagttgcaggtgttc
agtgctcagcggaagaaagaagcactgggaagaggaacaattaagcttctgtccagagca
gtcatgcatgctgtgtgtgagcagtgtggtttgaagataaatggaggtgaagttgcagtg
ttcgcctcccgtgcgggccctggtgtgtgctggcacccatcctgttttgtctgtttcacg
tgtaatgagctgctggtcgacctcatctatttttatcaggatggaaaaattcactgtggc
aggcaccatgcagaactgctcaaaccacggtgctcagcatgtgacgagataatttttgct
gatgagtgcacagaagctgagggtcgccattggcacatgaaacacttctgctgccttgag
tgtgaaacggtcctgggaggacagaggtatatcatgaaggacggccgccccttctgctgt
ggctgttttgagtctctctatgcggagtactgtgaaacctgtggggaacatattggtgtg
gaccatgcacagatgacctatgacgggcagcactggcacgccacggaagcctgcttttct
tgtgcccagtgtaaagcctctttgttgggatgtcccttccttcccaaacagggtcagatt
tactgctcaaaaacgtgcagtcttggtgaagacgtccatgcctctgattcttccgactct
gcatttcagtcagctcgatcaagagactcccgaagaagtgtccgaatgggcaagagcagc
cggtcagcagatcagtgtagacagtctctcctcttatcgcctgctctgaactacaagttt
cctggcctctcaggcaatgctgatgacaccctttctcgaaaattggatgatctgagtctc
tccagacaaggaacaagttttgccagtgaagaattttggaaaggcagagtagagcaggaa
actccagaagaccctgaagaatgggctgatcatgaagattatatgacgcagctcctcctc
aagtttggtgataaaagcctctttcagccacagcccaatgagatggatattcgagccagt
gagcactggatatctgataacatggttaaaagtaagaccgagttaaagcaaaataaccag
agccttgcaagtaaaaaataccagtctgatatgtactgggcacagtcacaagatggactg
ggcgattctgcttatggcagccacccaggccctgcaagcagtagaaggcttcaggaattg
gaactggaccatggggcttcagggtataatcatgatgaaacacagtggtatgaagattcc
ctggagtgtctgtcagacctgaaaccagagcaaagtgttcgggattcgatggattctttg
gcattgtccaatatcacaggggcttcggtggatggagaaaacaagccaaggccatcattg
tattctctgcaaaattttgaggagatggaaacagaagattgtgagaagatgagcaatatg
ggaactttgaactcttccatgctgcacaggagtgcagagtccttaaagagtctaagttca
gagttgtgtccagagaaaatcctgcctgaagagaagccagtacatctgccagtgctcaga
aggtccaagtctcaatccagaccccagcaggtcaagttttctgatgatgtcattgacaat
gggaactatgacattgaaatccggcagcctccgatgagtgaaaggactcggagacgcgtc
tacaattttgaagagaggggatccaggtctcatcaccaccgccgccggagaagtagaaag
tcccgctccgacaatgccctgaatcttgttacagaaagaaaatactctcccaaggacaga
ctgcggctgtacacccccgataactatgagaaatttatacagaataaaagtgcccgggag
atccaagcatacatccagaatgctgatctctacggacagtacgcccatgccacttccgat
tatggcctgcagaacccaggaatgaatcggtttctgggactctacggcgaggatgatgat
tcctggtgttcttcctcctcctcctcttccgactcggaagaagaaggatattttcttgga
caaccaatccctcaaccccggccacagagatttgcctactatacagatgacctttctagt
ccaccatctgcacttcccacccctcagtttggtcagaggacaacaaaatccaagaagaaa
aagggacacaagggcaaaaattgtattatttcttaa

KEGG   Homo sapiens (human): 166336
Entry
166336            CDS       T01001                                 

Symbol
PRICKLE2, EPM5
Name
(RefSeq) prickle planar cell polarity protein 2
  KO
K04511  prickle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H00810  Progressive myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    166336 (PRICKLE2)
SSDB
Motif
Pfam: PET LIM
Other DBs
NCBI-GeneID: 166336
NCBI-ProteinID: NP_942559
OMIM: 608501
HGNC: 20340
Ensembl: ENSG00000163637
Vega: OTTHUMG00000158789
Pharos: Q7Z3G6(Tdark)
UniProt: Q7Z3G6 A1LQZ3
Position
3p14.1
AA seq 844 aa
MVTVMPLEMEKTISKLMFDFQRNSTSDDDSGCALEEYAWVPPGLKPEQVHQYYSCLPEEK
VPYVNSPGEKLRIKQLLHQLPPHDNEVRYCNSLDEEEKRELKLFSSQRKRENLGRGNVRP
FPVTMTGAICEQCGGQINGGDIAVFASRAGHGVCWHPPCFVCTVCNELLVDLIYFYQDGK
IYCGRHHAECLKPRCAACDEIIFADECTEAEGRHWHMKHFCCFECETVLGGQRYIMKEGR
PYCCHCFESLYAEYCDTCAQHIGIDQGQMTYDGQHWHATETCFCCAHCKKSLLGRPFLPK
QGQIFCSRACSAGEDPNGSDSSDSAFQNARAKESRRSAKIGKNKGKTEEPMLNQHSQLQV
SSNRLSADVDPLSLQMDMLSLSSQTPSLNRDPIWRSREEPYHYGNKMEQNQTQSPLQLLS
QCNIRTSYSPGGQGAGAQPEMWGKHFSNPKRSSSLAMTGHAGSFIKECREDYYPGRLRSQ
ESYSDMSSQSFSETRGSIQVPKYEEEEEEEGGLSTQQCRTRHPISSLKYTEDMTPTEQTP
RGSMESLALSNATGLSADGGAKRQEHLSRFSMPDLSKDSGMNVSEKLSNMGTLNSSMQFR
SAESVRSLLSAQQYQEMEGNLHQLSNPIGYRDLQSHGRMHQSFDFDGGMAGSKLPGQEGV
RIQPMSERTRRRATSRDDNRRFRPHRSRRSRRSRSDNALHLASEREAISRLKDRPPLRAR
EDYDQFMRQRSFQESMGHGSRRDLYGQCPRTVSDLALQNAFGDRWGPYFAEYDWCSTCSS
SSESDNEGYFLGEPIPQPARLRYVTSDELLHKYSSYGLPKSSTLGGRGQLHSRKRQKSKN
CIIS
NT seq 2535 nt   +upstreamnt  +downstreamnt
atggtgacagtgatgccgctggagatggagaagaccatcagcaaactcatgtttgacttt
cagaggaactcgacctcagatgatgactcaggctgtgctttggaagagtatgcctgggtc
ccgccgggtctgaagcctgaacaggtacaccagtactatagctgtctcccagaagagaaa
gtcccttatgtcaacagtcctggagagaaactgcgaatcaagcagctactacaccagctg
ccgccacatgacaatgaggttcgatattgcaactccctggatgaggaagagaagagggag
ctgaagcttttcagcagccagaggaaacgcgaaaacttgggccgcgggaatgtcaggcct
ttcccagtcaccatgacaggagctatttgtgaacagtgcggaggccagatcaatggtgga
gacatcgctgtgtttgcgtcacgcgctggccacggcgtttgctggcacccgccgtgcttc
gtatgcactgtctgcaatgagctcctggtggatctgatctacttttaccaagatgggaag
atatactgtggcaggcaccatgctgagtgcctgaagccgcgctgtgctgcctgcgatgag
atcatctttgcagatgaatgcacagaagctgaggggcgacactggcacatgaaacacttt
tgctgcttcgagtgtgagacagtgctgggcggccagcgctacatcatgaaggagggaaga
ccctactgttgccactgcttcgagtccttgtatgcagaatattgtgacacctgtgcccaa
catataggtatcgaccaaggtcaaatgacctatgatggccaacactggcatgccactgag
acctgtttctgctgtgctcactgcaagaaatccctcctggggcggccattcctcccgaag
cagggccagatattctgctcacgggcctgcagtgctggggaagaccccaatggttctgac
tcctctgattccgccttccagaacgccagggccaaggagtcccggcgcagtgccaaaatt
ggcaagaacaagggcaagacggaggagcccatgctgaaccagcacagccagctgcaagtg
agttctaaccggctgtcagccgacgtagaccccctgtcactgcagatggacatgctcagc
ctgtccagccagacacccagcctcaaccgggaccccatctggaggagccgggaagagccc
taccattatgggaacaagatggagcagaaccagacccagagccctctgcagctcctcagc
cagtgcaacatcagaacttcctacagtccaggagggcaaggggctggggcccagcccgaa
atgtggggcaagcacttcagcaaccccaaaaggagctcgtcactggccatgacaggacat
gctggcagcttcatcaaggaatgccgagaagactattacccggggaggctgagatctcag
gagagctacagtgatatgtctagtcagagtttcagtgagacccgaggcagcatccaagtc
cccaaatatgaggaggaagaggaagaggaagggggcttgtccactcagcagtgtcggacc
cgtcatcccatcagttccctgaaatacacagaggacatgacgcccacagagcagacccct
cggggctccatggaatccctggccctgtctaatgcaacaggcctctctgctgatggtggt
gccaagcgccaggagcacctatcccgattttccatgcctgacctcagcaaagactctgga
atgaatgtgtctgagaagctgagcaacatgggcactcttaactcgtccatgcagttccgg
agcgcagagtcagttcgcagcctgctctctgcccagcagtaccaggagatggagggaaac
ctccaccagctcagcaaccccattggctacagagacctgcagtcccacggaaggatgcat
cagagctttgattttgatggagggatggcgggcagcaagctgccagggcaggagggcgtg
aggatccagcccatgagtgaacgcacccggagaagagctacttcacgcgacgacaaccgc
cgtttccgacctcacaggtccaggcgttcccgacgctctcgctccgacaacgccctccac
ctggccagcgaacgcgaggccatctcccggttaaaagataggccccctctgagagccagg
gaggactatgaccaatttatgcgccagcggagcttccaggagagcatggggcatgggtcc
cggagggacctgtacggccagtgccctaggactgtgtcggacctggctttgcagaatgcc
tttggggaccgctggggaccctacttcgccgagtatgattggtgttccacctgctcctcc
tcttcagagtctgacaacgagggctatttcctaggagaacccatcccccagccagcgcgc
ctgcgatacgtcacaagcgatgagctgctgcacaaatacagctcctacggcctccccaaa
tcttccacattaggtggcagaggacagttgcacagcaggaaaagacagaagagcaaaaac
tgtatcatttcttaa

DBGET integrated database retrieval system