KEGG   Homo sapiens (human): 144195
Entry
144195            CDS       T01001                                 
Symbol
SLC2A14, GLUT14, SLC2A3P3
Name
(RefSeq) solute carrier family 2 member 14
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Sugar_tr MFS_1 2-thiour_desulf
Other DBs
NCBI-GeneID: 144195
NCBI-ProteinID: NP_001273162
OMIM: 611039
HGNC: 18301
Ensembl: ENSG00000173262
Pharos: Q8TDB8(Tdark)
UniProt: Q8TDB8
Position
12:complement(7812514..7891196)
AA seq 520 aa
MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPET
IIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLI
VNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGT
LNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINR
KKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVL
QLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHM
IGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQG
PRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGR
TFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggagtttcacaatggtggccatgtgtctggaattggtgggttcttggtctcactgact
tcaagaatgaagccgcacaccctcgcagtcaccccagctctgatctttgccatcacagtt
gctacaatcggctctttccagtttggctacaacactggggtcatcaatgctcctgagacg
atcataaaggaatttatcaataaaactttgacggacaaggcaaatgcccctccctctgag
gtgctgctcacgaatctctggtccttgtctgtggccatattttccgtcgggggtatgatc
ggctccttttccgtcggactctttgttaaccgctttggcaggcgcaattcaatgctgatt
gtcaacctgttggctgccactggtggctgccttatgggactgtgtaaaatagctgagtca
gttgaaatgctgatcctgggccgcttggttattggcctcttctgcggactctgcacaggt
tttgtgcccatgtacattggagagatctcgcctactgccctgaggggtgcctttggcact
ctcaaccagctgggcatagttattggaattctggtggcccagatctttggtctggaactc
atccttgggtctgaagagctatggccggtgctattaggctttaccatccttccagctatc
ctgcaaagtgcagcccttccatgttgccctgaaagtcccagatttttgctcattaacaga
aaaaaagaggagaatgctacgcggatcctccagcggttgtggggcacccaggatgtatcc
caagacatccaggagatgaaagatgagagtgcaaggatgtcacaagaaaagcaagtcacc
gtgctggagctctttagagtgtccagctaccgacagcccatcatcatttccattgtgctc
cagctctctcagcagctctctgggatcaatgctgtgttctattactcaacaggaatcttc
aaggatgcaggtgttcaacagcccatctatgccaccatcagcgcgggtgtggttaatact
atcttcactttactttctctatttctggtggaaagggcaggaagaaggactctgcatatg
ataggccttggagggatggctttttgttccacgctcatgactgtttctttgttattaaag
aatcactataatgggatgagctttgtctgtattggggctatcttggtctttgtggcctgt
tttgaaattggaccaggccccattccctggtttattgtggccgaactcttcagccagggc
ccccgcccagctgcgatggcagtggccggctgctccaactggacctccaacttcctagtc
ggattgctcttcccctctgctgcttactatttaggagcctacgtttttattatcttcacc
ggcttcctcattaccttcttggcctttaccttcttcaaagtccctgagacccgtggcagg
acttttgaggatatcacacgggcctttgaagggcaggcacacggtgcagatagatctggg
aaggacggcgtcatggggatgaacagcatcgagcctgctaaggagaccaccaccaatgtc
taa

DBGET integrated database retrieval system