KEGG   Homo sapiens (human): 1442
Entry
1442              CDS       T01001                                 

Gene name
CSH1, CS-1, CSA, CSMT, GHB3, PL, hCS-1, hCS-A
Definition
(RefSeq) chorionic somatomammotropin hormone 1
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1442 (CSH1)
   04151 PI3K-Akt signaling pathway
    1442 (CSH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1442 (CSH1)
   04060 Cytokine-cytokine receptor interaction
    1442 (CSH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    1442 (CSH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1442 (CSH1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1442 (CSH1)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 1442
NCBI-ProteinID: NP_001308
OMIM: 150200
HGNC: 2440
Ensembl: ENSG00000136488
Vega: OTTHUMG00000171947
Pharos: P0DML2(Tbio)
CPD: C18210
UniProt: P0DML2 P0DML3 A8K6C2
Structure
PDB: 
1Z7C

Position
17q23.3
AA seq 217 aa
MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctccaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttcccttatccaggctttttgaccacgctatg
ctccaagcccatcgcgcgcaccagctggccattgacacctaccaggagtttgaagaaacc
tatatcccaaaggaccagaagtattcattcctgcatgactcccagacctccttctgcttc
tcagactctattccgacaccctccaacatggaggaaacgcaacagaaatccaatctagag
ctgctccgcatctccctgctgctcatcgagtcgtggctggagcccgtgcggttcctcagg
agtatgttcgccaacaacctggtgtatgacacctcggacagcgatgactatcacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagacggcagccgccgg
actgggcagatcctcaagcagacctacagcaagtttgacacaaactcgcacaaccatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatggtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Homo sapiens (human): 1443
Entry
1443              CDS       T01001                                 

Gene name
CSH2, CS-2, CSB, GHB1, PL, hCS-B
Definition
(RefSeq) chorionic somatomammotropin hormone 2
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1443 (CSH2)
   04151 PI3K-Akt signaling pathway
    1443 (CSH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1443 (CSH2)
   04060 Cytokine-cytokine receptor interaction
    1443 (CSH2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    1443 (CSH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1443 (CSH2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1443 (CSH2)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 1443
NCBI-ProteinID: NP_066271
OMIM: 118820
HGNC: 2441
Ensembl: ENSG00000213218
Vega: OTTHUMG00000172283
Pharos: P0DML3(Tbio)
UniProt: P0DML3 A0A0M6L0F6
Structure
PDB: 
1Z7C

Position
17q23.3
AA seq 217 aa
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttccgttatccaggctttttgaccacgctatg
ctccaagcccatcgcgcgcaccagctggccattgacacctaccaggagtttgaagaaacc
tatatcccaaaggaccagaagtattcattcctgcatgactcccagacctccttctgcttc
tcagactctattccgacaccctccaacatggaggaaacgcaacagaaatccaatctagag
ctgctccgcatctccctgctgctcatcgagtcgtggctggagcccgtgcggttcctcagg
agtatgttcgccaacaacctggtgtatgacacctcggacagcgatgactatcacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagacggcagccgccgg
actgggcagatcctcaagcagacctacagcaagtttgacacaaactcacacaaccatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatggtgcagtgccgctctgtagagggtagctgtggcttctag

KEGG   Homo sapiens (human): 2688
Entry
2688              CDS       T01001                                 

Gene name
GH1, GH, GH-N, GHB5, GHN, IGHD1A, IGHD1B, IGHD2, hGH-N
Definition
(RefSeq) growth hormone 1
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Network
nt06324  GHRH-GH-IGF signaling
  Element
N00907  GH-Jak-STAT signaling pathway
N00908  Mutation-inactivated GH to GH-Jak-STAT signaling pathway
N00909  Mutation-inactivated GHR to GH-Jak-STAT signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
Disease
H00254  Growth hormone deficiency
H02035  Isolated growth hormone deficiency
H02039  Kowarski syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2688 (GH1)
   04151 PI3K-Akt signaling pathway
    2688 (GH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2688 (GH1)
   04060 Cytokine-cytokine receptor interaction
    2688 (GH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    2688 (GH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2688 (GH1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   2688 (GH1)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 2688
NCBI-ProteinID: NP_000506
OMIM: 139250
HGNC: 4261
Ensembl: ENSG00000259384
Vega: OTTHUMG00000172293
Pharos: P01241(Tbio)
CPD: C18181
UniProt: P01241 B1A4G6
Structure
PDB: 

Position
17q23.3
AA seq 217 aa
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctacaggctcccggacgtccctgctcctggcttttggcctgctctgcctgccctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccatcgtctgcaccagctggcctttgacacctaccaggagtttgaagaagcc
tatatcccaaaggaacagaagtattcattcctgcagaacccccagacctccctctgtttc
tcagagtctattccgacaccctccaacagggaggaaacacaacagaaatccaacctagag
ctgctccgcatctccctgctgctcatccagtcgtggctggagcccgtgcagttcctcagg
agtgtcttcgccaacagcctggtgtacggcgcctctgacagcaacgtctatgacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagatggcagcccccgg
actgggcagatcttcaagcagacctacagcaagttcgacacaaactcacacaacgatgac
gcactactcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Homo sapiens (human): 2689
Entry
2689              CDS       T01001                                 

Gene name
GH2, GH-V, GHB2, GHL, GHV, hGH-V
Definition
(RefSeq) growth hormone 2
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Network
nt06324  GHRH-GH-IGF signaling
  Element
N00907  GH-Jak-STAT signaling pathway
N00909  Mutation-inactivated GHR to GH-Jak-STAT signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2689 (GH2)
   04151 PI3K-Akt signaling pathway
    2689 (GH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2689 (GH2)
   04060 Cytokine-cytokine receptor interaction
    2689 (GH2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    2689 (GH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2689 (GH2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   2689 (GH2)
SSDB
Motif
Pfam: Hormone_1 DUF594
Other DBs
NCBI-GeneID: 2689
NCBI-ProteinID: NP_002050
OMIM: 139240
HGNC: 4262
Ensembl: ENSG00000136487
Vega: OTTHUMG00000172284
Pharos: P01242(Tbio)
UniProt: P01242 A0A0M6L0J9
Position
17q23.3
AA seq 217 aa
MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEA
YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttggcctgctctgcctgtcctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccgtcgcctgtaccagctggcatatgacacctatcaggagtttgaagaagcc
tatatcctgaaggagcagaagtattcattcctgcagaacccccagacctccctctgcttc
tcagagtctattccaacaccttccaacagggtgaaaacgcagcagaaatctaacctagag
ctgctccgcatctccctgctgctcatccagtcatggctggagcccgtgcagctcctcagg
agcgtcttcgccaacagcctggtgtatggcgcctcggacagcaacgtctatcgccacctg
aaggacctagaggaaggcatccaaacgctgatgtggaggctggaagatggcagcccccgg
actgggcagatcttcaatcagtcctacagcaagtttgacacaaaatcgcacaacgatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

DBGET integrated database retrieval system