KEGG   Homo sapiens (human): 1444
Entry
1444              CDS       T01001                                 
Symbol
CSHL1, CS-5, CSHP1, CSL, GHB4, hCS-L
Name
(RefSeq) chorionic somatomammotropin hormone like 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Hormone_1 IL2
Other DBs
NCBI-GeneID: 1444
NCBI-ProteinID: NP_072101
OMIM: 603515
HGNC: 2442
Ensembl: ENSG00000204414
Pharos: Q14406(Tbio)
UniProt: Q14406 I6L999
Position
17:complement(63909608..63911258)
AA seq 222 aa
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISS
WGMEAYITKEQKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEP
VRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTN
SHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttcccttatccaggctttttaaagaggctatg
ctccaagcccatcgcgcacaccagctggccattgacacctaccaggagtttataagctct
tggggaatggaagcctatatcacaaaggaacagaagtattcattcctgcatgactcccag
acctccttctgcttctcagactctattccgacatcctccaacatggaggaaacgcagcag
aaatccaacttagagctgctccacatctccctgctgctcatcgagtcgcggctggagccc
gtgcggttcctcaggagtaccttcaccaacaacctggtgtatgacacctcggacagcgat
gactatcacctcctaaaggacctagaggaaggcatccaaatgctgatggggaggctggaa
gacggcagccacctgactgggcagaccctcaagcagacctacagcaagtttgacacaaac
tcgcacaaccatgacgcactgctcaagaactacgggctgctccactgcttcaggaaggac
atggacaaggtcgagacattcctgcgcatggtgcagtgccgctctgtggagggcagctgt
ggcttctag

DBGET integrated database retrieval system