KEGG   Homo sapiens (human): 144404
Entry
144404            CDS       T01001                                 
Symbol
TMEM120B
Name
(RefSeq) transmembrane protein 120B
  KO
K26608  transmembrane protein 120
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    144404 (TMEM120B)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   144404 (TMEM120B)
SSDB
Motif
Pfam: TMPIT HAUS-augmin3 Helo_like_N
Other DBs
NCBI-GeneID: 144404
NCBI-ProteinID: NP_001074294
OMIM: 616551
HGNC: 32008
Ensembl: ENSG00000188735
UniProt: A0PK00
Position
12:121712752..121782068
AA seq 339 aa
MSGQLERCEREWHELEGEFQELQETHRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLT
LQRCKRHASREEAELVQQMAANIKERQDVFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQ
AKFAYKDEYEKFKLYLTIILLLGAVACRFVLHYRVTDEVFNFLLVWYYCTLTIRESILIS
NGSRIKGWWVSHHYVSTFLSGVMLTWPNGPIYQKFRNQFLAFSIFQSCVQFLQYYYQRGC
LYRLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFCGHFWQLYNAVTLFELSSHEECRE
WQVFVLAFTFLILFLGNFLTTLKVVHAKLQKNRGKTKQP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtccgggcagctggagcgttgcgagcgcgaatggcacgagctggagggagaatttcaa
gaactgcaggagacgcacaggatctacaagcagaagctggaggagctggctgcgctgcag
acgctgtgtagcagttccatcagtaagcagaagaagcacctcaaggacttgaagcttaca
ctccagaggtgcaaacgccatgccagtcgggaggaggcggagctcgttcagcagatggca
gcgaacatcaaggagcggcaggacgtcttcttcgacatggaggcctacctgcccaagaag
aacgggctctacttgaacctggtcctcggcaatgtgaacgtgaccctcctcagcaaccag
gccaagttcgcctacaaggacgaatatgagaagttcaagctctacctgaccatcatcctg
ctcctgggtgccgtggcatgtcgatttgtccttcactacagggtgactgacgaagtcttc
aacttcctgctggtgtggtattactgcaccctgaccattcgggagagcattctcatcagc
aacggctcaagaattaaaggctggtgggtgtctcaccactacgtctccacattcctgtcc
ggagtgatgctgacctggcctaatggacccatttatcagaagtttcgcaaccagttctta
gcattttccatttttcagagctgcgtccagttcctgcaatattattaccagaggggctgc
ctctaccggctgcgggccctgggggagaggaaccacctggatctcacagtggaagggttc
cagtcctggatgtggcggggcctcacctttctcctgcccttcctcttctgtggccatttc
tggcagctctacaatgccgtcacgctgtttgagctctccagccacgaggaatgcagagaa
tggcaggtgttcgtactggcgttcaccttcctcatcctcttcctcggcaacttcctgacc
acgctcaaagtcgtgcatgccaagctccagaagaacagaggcaagacaaagcagccgtga

DBGET integrated database retrieval system