KEGG   Homo sapiens (human): 144501
Entry
144501            CDS       T01001                                 

Gene name
KRT80, KB20
Definition
(RefSeq) keratin 80
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    144501 (KRT80)
   04147 Exosome [BR:hsa04147]
    144501 (KRT80)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     144501 (KRT80)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   144501 (KRT80)
  Exosomal proteins of other body fluids (saliva and urine)
   144501 (KRT80)
  Exosomal proteins of colorectal cancer cells
   144501 (KRT80)
  Exosomal proteins of bladder cancer cells
   144501 (KRT80)
SSDB
Motif
Pfam: Filament Keratin_2_head Rhomboid_SP BRE1 Jnk-SapK_ap_N Phlebovirus_NSM
Other DBs
NCBI-GeneID: 144501
NCBI-ProteinID: NP_872313
OMIM: 611161
HGNC: 27056
Ensembl: ENSG00000167767
Vega: OTTHUMG00000150193
Pharos: Q6KB66(Tdark)
UniProt: Q6KB66
Position
12q13.13
AA seq 452 aa
MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTV
NPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQG
QDSAIFDLGHLYEEYQGRLQEELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTD
MEFTFVQLKKDLDAECLHRTELETKLKSLESFVELMKTIYEQELKDLAAQVKDVSVTVGM
DSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIA
DLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMA
RQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSK
APSRKKKGSKGPVIKITEMSEKYFSQESEVSE
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggcctgccgctcctgcgtggttggcttcagcagcctcagcagctgtgaggtgaccccg
gtgggcagcccccggcctggaacctcaggatgggacagctgcagggcccccgggccgggc
ttcagctcccgcagcctcacaggctgctggtcggctggcactatctccaaggtgactgtg
aaccccggcctgctggtgcccctggatgtcaagttggaccccgctgttcagcagctgaag
aaccaggagaaggaggagatgaaggccctcaatgataaatttgcctccctaattggcaag
gtgcaagccctggaacagcgcaaccagctgctggagacacgctggagcttcctgcagggc
caggactcagccatcttcgacctcgggcatctctatgaggaatatcagggccggctgcag
gaggaactgcgcaaagtgagccaggagcgggggcagctggaggccaacctgctgcaggtg
ctggagaaggttgaggagtttcgaatcaggtatgaggatgagatctccaagcgcacagac
atggagttcacctttgttcagctgaagaaggacctggatgcagagtgtcttcatcggact
gaactggaaaccaagttaaaaagcctggagagcttcgtggagttgatgaaaaccatctat
gagcaggagctgaaggacctggcagcacaggtgaaggatgtgtcggtgaccgtcggcatg
gacagccgctgccacatcgacctgagcggcatcgtggaggaggtgaaggcccagtatgac
gccgtcgcggctcgcagcctggaggaggccgaggcatactctcggagccagctggaggag
caggccgcccgctcggccgagtatgggagcagcctccagagcagccgcagcgagatcgcg
gatctcaatgtgcgcatccagaagctgcggtcccagatcctctctgtcaagagccattgc
ctgaaactggaggagaacatcaagacagctgaggagcagggtgagctggccttccaggat
gccaagaccaagctggcccagctggaggccgccctgcagcaggccaagcaggacatggcg
cggcagctgcgcaagtaccaggagctgatgaacgtcaagctggccctggacatcgagatc
gccacctacaggaagctggtggagggcgaggagggcaggatggactcgccctcagccact
gtggtcagcgctgtgcagtccaggtgcaaaaccgctgcctccagatcaggcctctccaag
gccccctcccgaaagaagaagggcagcaaaggccccgtgatcaaaatcaccgaaatgtca
gagaagtacttctcgcaggagtcggaggtctcagagtaa

DBGET integrated database retrieval system