KEGG   Homo sapiens (human): 1446
Entry
1446              CDS       T01001                                 
Symbol
CSN1S1, CASA, CSN1
Name
(RefSeq) casein alpha s1
  KO
K17281  alpha-S1-casein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1446 (CSN1S1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   1446 (CSN1S1)
SSDB
Motif
Pfam: Casein
Other DBs
NCBI-GeneID: 1446
NCBI-ProteinID: NP_001881
OMIM: 115450
HGNC: 2445
Ensembl: ENSG00000126545
Pharos: P47710(Tbio)
UniProt: P47710
Position
4:69931068..69946574
AA seq 185 aa
MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQ
TDEIKDTRNESTQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQ
EQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNN
VMLQW
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaggcttctcattctcacctgtcttgtggctgttgctcttgccaggcctaaacttcct
cttagatacccagaacgccttcagaatccatcagagagcagtgagcctataccattagaa
tcaagagaggaatacatgaatggtatgaacaggcagagaaacattctgagagaaaaacag
actgatgaaatcaaggatactaggaatgagtctactcagaactgtgttgtggcagagcct
gagaagatggaatccagcatcagttcatcgagtgaggaaatgtctctcagtaagtgtgcg
gaacagttttgtagactgaacgaatacaaccaacttcagctgcaagctgcccatgcccag
gagcaaattcgcagaatgaatgaaaacagccatgtccaagtgcctttccagcagctcaac
caacttgctgcctacccctatgctgtttggtactatccacaaatcatgcagtatgttcct
ttcccaccgttttccgacatctccaatcccactgctcatgaaaattatgaaaaaaataac
gtcatgctacagtggtga

DBGET integrated database retrieval system