KEGG   Homo sapiens (human): 144699Help
Entry
144699            CDS       T01001                                 

Gene name
FBXL14, Fbl14
Definition
(RefSeq) F-box and leucine rich repeat protein 14
  KO
K10280  F-box and leucine-rich repeat protein 14
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    144699 (FBXL14)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     144699 (FBXL14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 LRR_4 F-box-like F-box SAM_Ste50p
Motif
Other DBs
NCBI-GeneID: 144699
NCBI-ProteinID: NP_689654
OMIM: 609081
HGNC: 28624
Ensembl: ENSG00000171823
Vega: OTTHUMG00000090369
Pharos: Q8N1E6(Tdark)
UniProt: Q8N1E6
Position
12p13.33
AA seq 418 aa AA seqDB search
METHISCLFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPS
LFPSLQARGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLR
ALNLSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCR
HLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGG
ISDAGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYI
AQGLDGLKSLSLCSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTG
IDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSSRR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggagacccacatctcatgcctgttcccggagctgctggccatgatcttcggctacctg
gacgtccgggacaaggggcgcgcggcgcaggtgtgcaccgcctggcgggacgccgcctac
cacaagtcggtgtggcggggggtggaggccaagctgcacctgcgccgggccaacccgtcg
ctgttccccagcctgcaggcccggggcatccgccgggtgcagatcctgagcctccgccgc
agcctcagctacgtgatccagggcatggccaacatcgagagcctcaacctcagcggctgc
tacaacctcaccgacaacgggctgggccacgcgtttgtgcaggagatcggctccctgcgc
gctctcaacctgagcctctgcaagcagatcactgacagcagcctgggccgcatagcccag
tacctcaagggcctggaggtgctggagctgggaggttgcagcaacatcaccaacactggc
cttctgctcatcgcctggggtctgcagcgcctcaagagccttaacctccgcagctgccgc
cacctttcggatgtgggcatcgggcacctggccggcatgacgcgcagcgcggcggagggc
tgcctgggcctggagcagctcacgctacaggactgccagaagctcacagatctttctcta
aagcacatctcccgagggctgacgggcctgaggctcctcaacctcagcttctgtggggga
atctcggacgctggcctcctgcacctgtcgcacatgggcagcctgcgcagcctcaacctg
cgctcctgtgacaacatcagtgacacgggcatcatgcatctggccatgggcagcctgcgc
ctctcggggctggatgtttcgttctgtgacaaggtgggagaccagagtctggcttacata
gcccaggggctggatggcctcaagtctctctccctctgctcctgccacatcagtgatgat
ggcatcaaccgcatggtgcggcagatgcacgggctgcgcacgctcaacattggacagtgt
gtgcgcatcacggacaagggcctggagctgatcgctgagcacctgagccaactcaccggc
atagacctgtacggctgcacccgaatcaccaagcgcggcctggagcgcatcacgcagctg
ccgtgcctcaaggtactcaacctgggactctggcagatgacggacagtgagaaggaggca
cgaggggatttttctccattattcactgtgagaactcggggaagctccagaaggtga

DBGET integrated database retrieval system