KEGG   Homo sapiens (human): 144983Help
Entry
144983            CDS       T01001                                 

Gene name
HNRNPA1L2
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A1-like 2
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    144983 (HNRNPA1L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    144983 (HNRNPA1L2)
   03041 Spliceosome [BR:hsa03041]
    144983 (HNRNPA1L2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     144983 (HNRNPA1L2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     144983 (HNRNPA1L2)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    144983 (HNRNPA1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 HnRNPA1 RRM_7 Nup35_RRM_2 PHM7_cyt
Motif
Other DBs
NCBI-GeneID: 144983
NCBI-ProteinID: NP_001011724
HGNC: 27067
Ensembl: ENSG00000139675
Vega: OTTHUMG00000016972
Pharos: Q32P51(Tdark)
UniProt: Q32P51 A0A024QZ98
Position
13q14.3
AA seq 320 aa AA seqDB search
MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNTTPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVKGHNCEVRKA
LPKQEMASASSSQRGRRGSGNFGGGRGDGFGGNDNFGRGGNFSGRGGFGGSCGGGGYGGS
GDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPQ
NQGGYGVSSSSSSYGSGRRF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagtcagcgtctccaaaagagcccgaacagctgaggaagctcttcattggaggg
ttgagctttgaaacaactgatgagagcctgaggagccattttgagcaatggggaacgctc
acagactgtgtggtaatgagagatccaaacaccaagcgctccaggggctttgggtttgtc
acatatgccactgtggaggaggtggatgcagctatgaatacaacgccacacaaggtggat
ggaagagttgtggaaccaaagagagctgtctccagagaagattctcaaagaccaggtgcc
cacttaactgtgaaaaagatatttgttggtggcattaaagaagacactgaagaacatcac
ctaagagattattttgaacagtatggaaaaattgaagtaattgaaatcatgactgaccga
ggcagtggcaagaaaaggggctttgcctttgtaacctttgacgaccatgactccgtggat
aagattgtcattcagaaataccatactgtgaagggccacaactgtgaagttagaaaagcc
ctgccaaagcaagagatggctagtgcttcatccagccaaagaggtcgaaggggttctgga
aactttggtggtggtcgtggagatggtttcggtgggaatgacaactttggtcgtggagga
aacttcagtggtcgtggtggctttggtggcagctgtggtggtggtggatatggtggcagt
ggggatggctataatggatttggtaatgatggaagcaattttggaggtggtggaagctac
aatgattttggcaattacaacaatcagtcttcaaattttggacccatgaagggaggaaat
tttggaggcagaagctctggcccctatggcggtggaggccaatactttgcaaaaccacaa
aaccaaggtggctatggcgtttccagcagcagcagtagctatggcagtggcagaagattt
taa

KEGG   Homo sapiens (human): 220988Help
Entry
220988            CDS       T01001                                 

Gene name
HNRNPA3, 2610510D13Rik, D10S102, FBRNP, HNRPA3
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A3
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    220988 (HNRNPA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    220988 (HNRNPA3)
   03041 Spliceosome [BR:hsa03041]
    220988 (HNRNPA3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     220988 (HNRNPA3)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     220988 (HNRNPA3)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    220988 (HNRNPA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 PHM7_cyt
Motif
Other DBs
NCBI-GeneID: 220988
NCBI-ProteinID: NP_001317178
OMIM: 605372
HGNC: 24941
Ensembl: ENSG00000170144
Vega: OTTHUMG00000132529
Pharos: P51991(Tbio)
UniProt: P51991
Position
2q31.2
AA seq 378 aa AA seqDB search
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGT
LTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPG
AHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTV
DKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRG
GNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQG
GGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPY
GGGYGSGGGSGGYGSRRF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaggtaaaaccgccgcccggtcgcccccagcccgactccggccgtcgccgtcgccgc
cggggggaggagggccatgatccaaaggaaccagagcagttgagaaaactgtttattggt
ggtctgagctttgaaactacagatgatagtttacgagaacattttgagaaatggggcaca
ctcacagattgtgtggtaatgagagacccccaaacaaaacgttccaggggctttggtttt
gtgacttattcttgtgttgaagaggtggatgcagcaatgtgtgctcgaccacacaaggtt
gatgggcgtgtagtggaaccaaagagagctgtttctagagaggattctgtaaagcctggt
gcccatctaacagtgaagaaaatttttgttggtggtattaaagaagatacagaagaatat
aatttgagagactactttgaaaagtatggcaagattgaaaccatagaagttatggaagac
aggcagagtggaaaaaagagaggatttgcttttgtaacttttgatgatcatgatacagtt
gataaaattgttgttcagaaataccacactattaatgggcataattgtgaagtgaaaaag
gccctttctaaacaagagatgcagtctgctggatcacagagaggtcgtggaggtggatct
ggcaattttatgggtcgcggagggaactttggaggtggtggaggtaattttggccgtggt
ggaaactttggtggaagaggaggctatggtggtggaggtggtggcagcagaggtagttat
ggaggaggtgatggtggatataatggatttggaggtgatggtggcaactatggcggtggt
cctggttatagtagtagagggggctatggtggtggtggaccaggatatggaaaccaaggt
ggtggatatggtggaggtggaggatatgatggttacaatgaaggaggaaattttggcggt
ggtaactatggtggtggtgggaactataatgattttggaaattatagtggacaacagcaa
tcaaattatggacccatgaaagggggcagttttggtggaagaagctcgggcagtccctat
ggtggtggttatggatctggtggtggaagtggtggatatggtagcagaaggttctaa

KEGG   Homo sapiens (human): 27316Help
Entry
27316             CDS       T01001                                 

Gene name
RBMX, HNRNPG, HNRPG, MRXS11, RBMXP1, RBMXRT, RNMX, hnRNP-G
Definition
(RefSeq) RNA binding motif protein X-linked
  KO
K12885  heterogeneous nuclear ribonucleoprotein G
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H00658  Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    27316 (RBMX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    27316 (RBMX)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    27316 (RBMX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RBM1CTR RRM_7 RRM_5 RRM_occluded PHM7_cyt
Motif
Other DBs
NCBI-GeneID: 27316
NCBI-ProteinID: NP_002130
OMIM: 300199
HGNC: 9910
Ensembl: ENSG00000147274
Vega: OTTHUMG00000022517
Pharos: P38159(Tbio)
UniProt: P38159
Structure
PDB: 

Position
Xq26.3
AA seq 391 aa AA seqDB search
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPA
DAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTR
GPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGR
APVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRD
YTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGP
PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPP
RDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagcagatcgcccaggaaagctcttcattggtgggcttaatacggaaacaaat
gagaaagctcttgaagcagtatttggcaaatatggacgaatagtggaagtactcttgatg
aaagaccgtgaaaccaacaaatcaagaggatttgcttttgtcacctttgaaagcccagca
gacgctaaggatgcagccagagacatgaatggaaagtcattagatggaaaagccatcaag
gtggaacaagccaccaaaccatcatttgaaagtggtagacgtggaccgcctccacctcca
agaagtagaggccctccaagaggtcttagaggtggaagaggaggaagtggaggaaccagg
ggacctccctcacggggaggacacatggatgacggtggatattccatgaattttaacatg
agttcttccaggggaccactcccagtaaaaagaggaccaccaccaagaagtgggggtcct
cctcctaagagatctgcaccttcaggaccagttcgcagtagcagtggaatgggaggaaga
gctcctgtatcacgtggaagagatagttatggaggtccacctcgaagggaaccgctgccc
tctcgtagagatgtttatttgtccccaagagatgatgggtattctactaaagacagctat
tcaagcagagattacccaagttctcgtgatactagagattatgcaccaccaccacgagat
tatacttaccgtgattatggtcattccagttcacgtgatgactatccatcaagaggatat
agcgatagagatggatatggtcgtgatcgtgactattcagatcatccaagtggaggttcc
tacagagattcatatgagagttatggtaactcacgtagtgctccacctacacgagggccc
ccgccatcttatggtggaagcagtcgctatgatgattacagcagctcacgtgacggatat
ggtggaagtcgagacagttactcaagcagccgaagtgatctctactcaagtggtcgtgat
cgggttggcagacaagaaagagggcttcccccttctatggaaagggggtaccctcctcca
cgtgattcctacagcagttcaagccgcggagcaccaagaggtggtggccgtggaggaagc
cgatctgatagagggggaggcagaagcagatactag

KEGG   Homo sapiens (human): 3178Help
Entry
3178              CDS       T01001                                 

Gene name
HNRNPA1, ALS19, ALS20, HNRPA1, HNRPA1L3, IBMPFD3, UP_1, hnRNP_A1, hnRNP-A1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A1
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H02031  Inclusion body myopathy with Paget disease of bone and frontotemporal dementia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3178 (HNRNPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    3178 (HNRNPA1)
   03041 Spliceosome [BR:hsa03041]
    3178 (HNRNPA1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     3178 (HNRNPA1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     3178 (HNRNPA1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    3178 (HNRNPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 HnRNPA1 RRM_7 Nup35_RRM_2 PHM7_cyt
Motif
Other DBs
NCBI-GeneID: 3178
NCBI-ProteinID: NP_112420
OMIM: 164017
HGNC: 5031
Ensembl: ENSG00000135486
Vega: OTTHUMG00000169702
Pharos: P09651(Tchem)
UniProt: P09651 A0A024RAZ7
Structure
PDB: 

Position
12q13.13
AA seq 372 aa AA seqDB search
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA
LSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGS
GDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGG
GSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGS
SSSSSYGSGRRF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagtcagagtctcctaaagagcccgaacagctgaggaagctcttcattggaggg
ttgagctttgaaacaactgatgagagcctgaggagccattttgagcaatggggaacgctc
acggactgtgtggtaatgagagatccaaacaccaagcgctccaggggctttgggtttgtc
acatatgccactgtggaggaggtggatgcagctatgaatgcaaggccacacaaggtggat
ggaagagttgtggaaccaaagagagctgtctccagagaagattctcaaagaccaggtgcc
cacttaactgtgaaaaagatatttgttggtggcattaaagaagacactgaagaacatcac
ctaagagattattttgaacagtatggaaaaattgaagtgattgaaatcatgactgaccga
ggcagtggcaagaaaaggggctttgcctttgtaacctttgacgaccatgactccgtggat
aagattgtcattcagaaataccatactgtgaatggccacaactgtgaagttagaaaagcc
ctgtcaaagcaagagatggctagtgcttcatccagccaaagaggtcgaagtggttctgga
aactttggtggtggtcgtggaggtggtttcggtgggaatgacaacttcggtcgtggagga
aacttcagtggtcgtggtggctttggtggcagccgtggtggtggtggatatggtggcagt
ggggatggctataatggatttggtaatgatggtggttatggaggaggcggccctggttac
tctggaggaagcagaggctatggaagtggtggacagggttatggaaaccagggcagtggc
tatggcgggagtggcagctatgacagctataacaacggaggcggaggcggctttggcggt
ggtagtggaagcaattttggaggtggtggaagctacaatgattttgggaattacaacaat
cagtcttcaaattttggacccatgaagggaggaaattttggaggcagaagctctggcccc
tatggcggtggaggccaatactttgcaaaaccacgaaaccaaggtggctatggcggttcc
agcagcagcagtagctatggcagtggcagaagattttaa

KEGG   Homo sapiens (human): 3183Help
Entry
3183              CDS       T01001                                 

Gene name
HNRNPC, C1, C2, HNRNP, HNRPC, SNRPC
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein C (C1/C2)
  KO
K12884  heterogeneous nuclear ribonucleoprotein C1/C2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3183 (HNRNPC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3183 (HNRNPC)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    3183 (HNRNPC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 APG6 Nup88 RP-C_C
Motif
Other DBs
NCBI-GeneID: 3183
NCBI-ProteinID: NP_001070910
OMIM: 164020
HGNC: 5035
Ensembl: ENSG00000092199
Vega: OTTHUMG00000170757
Pharos: P07910(Tbio)
UniProt: P07910
Structure
PDB: 

Position
14q11.2
AA seq 306 aa AA seqDB search
MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNE
RNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSS
SFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQR
GSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSS
SVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSA
NGEDDS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacgttaccaacaagacagatcctcgctccatgaactcccgtgtattcatt
gggaatctcaacactcttgtggtcaagaaatctgatgtggaggcaatcttttcgaagtat
ggcaaaattgtgggctgctctgttcataagggctttgccttcgttcagtatgttaatgag
agaaatgcccgggctgctgtagcaggagaggatggcagaatgattgctggccaggtttta
gatattaacctggctgcagagccaaaagtgaaccgaggaaaagcaggtgtgaaacgatct
gcagcggagatgtacgggtcagtaacagaacacccttctccgtcccctctactcagctcc
tcttttgacttggactatgactttcaacgggactattatgataggatgtacagttaccca
gcacgtgtacctcctcctcctcctattgctcgggctgtagtgccctcgaaacgtcagcgt
gtatcaggaaacacttcacgaaggggcaaaagtggcttcaattctaagagtggacagcgg
ggatcttccaagtctggaaagttgaaaggagatgaccttcaggccattaagaaggagctg
acccagataaaacaaaaagtggattctctcctggaaaacctggaaaaaattgaaaaggaa
cagagcaaacaagcagtagagatgaagaatgataagtcagaagaggagcagagcagcagc
tccgtgaagaaagatgagactaatgtgaagatggagtctgaggggggtgcagatgactct
gctgaggagggggacctactggatgatgatgataatgaagatcggggggatgaccagctg
gagttgatcaaggatgatgaaaaagaggctgaggaaggagaggatgacagagacagcgcc
aatggcgaggatgactcttaa

KEGG   Homo sapiens (human): 3190Help
Entry
3190              CDS       T01001                                 

Gene name
HNRNPK, AUKS, CSBP, HNRPK, TUNP
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein K
  KO
K12886  heterogeneous nuclear ribonucleoprotein K
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex infection
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
Network
N00270  HCV Core to host-cell-protein inhibition
Disease
H01930  Au-Kline syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3190 (HNRNPK)
 09160 Human Diseases
  09161 Cancers
   05206 MicroRNAs in cancer
    3190 (HNRNPK)
   05203 Viral carcinogenesis
    3190 (HNRNPK)
  09167 Infectious diseases
   05168 Herpes simplex infection
    3190 (HNRNPK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3190 (HNRNPK)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    3190 (HNRNPK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KH_1 ROKNT KH_2 KH_4 KH_5 DJ-1_PfpI Phi-29_GP3
Motif
Other DBs
NCBI-GeneID: 3190
NCBI-ProteinID: NP_001305117
OMIM: 600712
HGNC: 5044
Ensembl: ENSG00000165119
Vega: OTTHUMG00000020107
Pharos: P61978(Tbio)
UniProt: P61978
Structure
PDB: 

Position
9q21.32
AA seq 463 aa AA seqDB search
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgaacagccagaagaaaccttccctaacactgaaaccaatggtgaatttggt
aaacgccctgcagaagatatggaagaggaacaagcatttaaaagatctagaaacactgat
gagatggttgaattacgcattctgcttcagagcaagaatgctggggcagtgattggaaaa
ggaggcaagaatattaaggctctccgtacagactacaatgccagtgtttcagtcccagac
agcagtggccccgagcgcatattgagtatcagtgctgatattgaaacaattggagaaatt
ctgaagaaaatcatccctaccttggaagagggcctgcagttgccatcacccactgcaacc
agccagctcccgctcgaatctgatgctgtggaatgcttaaattaccaacactataaagga
agtgactttgactgcgagttgaggctgttgattcatcagagtctagcaggaggaattatt
ggggtcaaaggtgctaaaatcaaagaacttcgagagaacactcaaaccaccatcaagctt
ttccaggaatgctgtcctcattccactgacagagttgttcttattggaggaaaacccgat
agggttgtagagtgcataaagatcatccttgatcttatatctgagtctcccatcaaagga
cgtgcacagccttatgatcccaatttttacgatgaaacctatgattatggtggttttaca
atgatgtttgatgaccgtcgcggacgcccagtgggatttcccatgcggggaagaggtggt
tttgacagaatgcctcctggtcggggtgggcgtcccatgcctccatctagaagagattat
gatgatatgagccctcgtcgaggaccacctccccctcctcccggacgaggcggccggggt
ggtagcagagctcggaatcttcctcttcctccaccaccaccacctagagggggagacctc
atggcctatgacagaagagggagacctggagaccgttacgacggcatggttggtttcagt
gctgatgaaacttgggactctgcaatagatacatggagcccatcagaatggcagatggct
tatgaaccacagggtggctccggatatgattattcctatgcagggggtcgtggctcatat
ggtgatcttggtggacctattattactacacaagtaactattcccaaagatttggctgga
tctattattggcaaaggtggtcagcggattaaacaaatccgtcatgagtcgggagcttcg
atcaaaattgatgagcctttagaaggatccgaagatcggatcattaccattacaggaaca
caggaccagatacagaatgcacagtatttgctgcagaacagtgtgaagcagtattctgga
aagtttttctaa

KEGG   Homo sapiens (human): 3192Help
Entry
3192              CDS       T01001                                 

Gene name
HNRNPU, EIEE54, GRIP120, HNRNPU-AS1, HNRPU, SAF-A, SAFA, U21.1, hnRNP_U, pp120, C1orf199, NCRNA00201
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein U
  KO
K12888  heterogeneous nuclear ribonucleoprotein U
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3192 (HNRNPU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3192 (HNRNPU)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    3192 (HNRNPU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_33 SPRY SAP AAA_18 SRP54 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 3192
NCBI-ProteinID: NP_114032
OMIM: 602869
HGNC: 5048
Ensembl: ENSG00000153187
Vega: OTTHUMG00000040396
Pharos: Q00839(Tbio)
UniProt: Q00839 Q96BA7
Position
1q44
AA seq 825 aa AA seqDB search
MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSL
DLGGDSAGRSGAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGP
MEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAA
KEAAGKSSGPTSLFAVTVAPPGARQGQQQAGGKKKAEGGGGGGRPGAPAAGDGKTEQKGG
DKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK
ISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVR
IGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELS
YAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVP
LEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVA
GFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQ
RKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKE
EAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFR
GGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRG
NYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgagttcctcgcctgttaatgtaaaaaagctgaaggtgtcggagctgaaagaggagctc
aagaagcgacgcctttctgacaagggtctcaaggccgagctcatggagcgactccaggct
gcgctggacgacgaggaggccgggggccgccccgccatggagcccgggaacggcagccta
gacctgggcggggattccgctgggcgctcgggagcaggcctcgagcaggaggccgcggcc
ggcggcgatgaagaggaggaggaagaggaagaggaggaggaaggaatctccgctctggac
ggcgaccagatggagctaggagaggagaacggggccgcgggggcggccgactcgggcccg
atggaggaggaggaggccgcctcggaagacgagaacggcgacgatcagggtttccaggaa
ggggaagatgagctcggggacgaagaggaaggcgcgggcgacgagaacgggcacggggag
cagcagcctcaaccgccggcgacgcagcagcaacagccccaacagcagcgcggggccgcc
aaggaggccgcggggaagagcagcggccccacctcgctgttcgcggtgacggtggcgccg
cccggggcgaggcagggccagcagcaggcgggaggtaagaagaaggcggaaggcggcgga
ggcggcggtcgccccggggctccggcggcgggggacggcaaaacagaacagaaaggcgga
gataaaaagaggggtgttaaaagaccacgagaagatcatggccgtggatattttgagtac
attgaagagaacaagtatagcagagccaaatctcctcagccacctgttgaagaagaagat
gaacacttcgatgacacagtggtttgtcttgatacttataattgtgatctacattttaaa
atatcaagagatcgtctcagtgcttcttcccttacaatggagagttttgcttttctttgg
gctggaggaagagcatcctatggtgtgtcaaaaggcaaagtgtgttttgagatgaaggtt
acagagaagatcccagtaaggcatttatatacaaaagatattgacatacatgaagttcgt
attggctggtcactaactacaagtggaatgttacttggtgaagaagaattttcttatggg
tattctctaaaaggaataaaaacatgcaactgtgagactgaagattatggagaaaagttt
gatgaaaatgatgtgattacatgttttgctaactttgaaagtgatgaagtagaactctcg
tatgctaagaatggacaagatcttggcgttgccttcaaaatcagtaaggaagttcttgct
ggacggccactgttcccgcatgttctctgccacaactgtgcagttgaatttaattttggt
cagaaggaaaagccatattttccaatacctgaagagtatactttcatccagaacgtcccc
ttagaggatcgagttagaggaccaaaggggcctgaagagaagaaagattgtgaagttgtg
atgatgattggcttgccaggagctggaaaaactacctgggttactaaacatgcagcagaa
aatccagggaaatataacattcttggcacaaatactattatggataagatgatggtggca
ggttttaagaagcaaatggcagatactggaaaactgaacacactgttgcagagagccccc
cagtgtcttgggaaatttattgagattgctgcccgaaagaagcgaaattttattctggat
cagacaaatgtgtctgctgctgcccagaggagaaaaatgtgcctgtttgcaggcttccag
cgaaaagctgttgtagtttgcccaaaagatgaagactataagcaaagaacacagaagaaa
gcagaagtagaggggaaagacctaccagaacatgcggtcctcaaaatgaaaggaaacttt
accctcccagaggtagctgagtgctttgatgaaataacctatgttgaacttcagaaggaa
gaagcccaaaaactcttggagcaatataaggaagaaagcaaaaaggctcttccaccagaa
aagaaacagaacactggctcaaagaaaagcaataaaaataagagtggcaagaaccagttt
aacagaggtggtggccatagaggacgtggaggattcaatatgcgtggtggaaatttcaga
ggaggagcccctgggaatcgtggcggatataataggaggggcaacatgccacagagaggt
ggtggcggtggaggaagtggtggaatcggctatccataccctcgtgcccctgtttttcct
ggccgtggtagttactcaaacagagggaactacaacagaggtggaatgcccaacagaggg
aactacaaccagaacttcagaggacgaggaaacaatcgtggctacaaaaatcaatctcag
ggctacaaccagtggcagcagggtcaattctggggtcagaagccatggagtcagcattat
caccaaggatattattga

KEGG   Homo sapiens (human): 4670Help
Entry
4670              CDS       T01001                                 

Gene name
HNRNPM, CEAR, HNRNPM4, HNRPM, HNRPM4, HTGR1, NAGR1, hnRNP_M
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein M
  KO
K12887  heterogeneous nuclear ribonucleoprotein M
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4670 (HNRNPM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    4670 (HNRNPM)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4670 (HNRNPM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 HnRNP_M Limkain-b1 Collagen_mid RRM_occluded RRM_5
Motif
Other DBs
NCBI-GeneID: 4670
NCBI-ProteinID: NP_005959
OMIM: 160994
HGNC: 5046
Ensembl: ENSG00000099783
Vega: OTTHUMG00000182383
Pharos: P52272(Tbio)
UniProt: P52272
Structure
PDB: 

Position
19p13.2
AA seq 730 aa AA seqDB search
MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNR
FEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFK
MEESMKKAAEVLNKHSLSGRPLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMITIP
PSILNNPNIPNEIIHALQAGRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKD
GKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQLPHG
LGGIGMGLGPGGQPIDANHLNKGIGMGNIGPAGMGMEGIGFGINKMGGMEGPFGGGMENM
GRFGSGMNMGRINEILSNALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGGAGMERMG
AGLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIERMGPLGLDHMASSIERMGQTMERIG
SGVERMGAGMGFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSMERMVPAGMGAG
LERMGPVMDRMATGLERMGANNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPAL
GAGIERMGLAMGGGGGASFDRAIEMERGNFGGSFAGSFGGAGGHAPGVARKACQIFVRNL
PFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGR
EIDVRIDRNA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggggtcgaagcggcggcggaggtggcggcgacggagatcaaaatggaggaa
gagagcggcgcgcccggcgtgccgagcggcaacggggctccgggccctaagggtgaagga
gaacgacctgctcagaatgagaagaggaaggagaaaaacataaaaagaggaggcaatcgc
tttgagccatatgccaatccaactaaaagatacagagccttcattacaaacatacctttt
gatgtgaaatggcagtcacttaaagacctggttaaagaaaaagttggtgaggtaacatac
gtggagctcttaatggacgctgaaggaaagtcaaggggatgtgctgttgttgaattcaag
atggaagagagcatgaaaaaagctgcggaagtcctaaacaagcatagtctgagcggaaga
ccactgaaagtcaaagaagatcctgatggtgaacatgccaggagagcaatgcaaaaggtg
atggctacgactggtgggatgggtatgggaccaggtggcccaggaatgattactatccca
cccagtatcctaaataatcccaacatcccaaatgagattatccatgcattacaggctgga
agacttggaagcacagtatttgtagcaaatctggattataaagttggctggaagaaactg
aaggaagtatttagtatggctggtgtggtggtccgagcagacattcttgaagataaagat
ggaaaaagtcgtggaataggcactgttacttttgaacagtccattgaagctgtgcaagct
atatctatgttcaatggccagctgctatttgatagaccaatgcacgtcaagatggatgag
agggccttaccaaaaggagatttcttccctcctgagcgtccacaacaacttccccatggc
cttggtggtattggcatggggttaggaccaggagggcaacccattgatgccaatcacctg
aataaaggcatcggaatgggaaacataggtcccgcaggaatgggaatggaaggcatagga
tttggaataaataaaatgggaggaatggaggggccctttggtggtggtatggaaaacatg
ggtcgatttggatctgggatgaacatgggcaggataaatgaaatcctaagtaatgcactg
aagagaggagagatcattgcaaagcagggaggaggtggaggtggaggaagcgtccctggg
atcgagaggatgggtcctggcattgaccgcctcgggggtgccggcatggagcgcatgggc
gcgggcctgggccacggcatggatcgcgtgggctccgagatcgagcgcatgggcctggtc
atggaccgcatgggctccgtggagcgcatgggctccggcattgagcgcatgggcccgctg
ggcctcgaccacatggcctccagcattgagcgcatgggccagaccatggagcgcattggc
tctggcgtggagcgcatgggtgccggcatgggcttcggccttgagcgcatggccgctccc
atcgaccgtgtgggccagaccattgagcgcatgggctctggcgtggagcgcatgggccct
gccatcgagcgcatgggcctgagcatggagcgcatggtgcccgcaggtatgggagctggc
ctggagcgcatgggccccgtgatggatcgcatggccaccggcctggagcgcatgggcgcc
aacaatctggagcggatgggcctggagcgcatgggcgccaacagcctcgagcgcatgggc
ctggagcgcatgggtgccaacagcctcgagcgcatgggccctgccatgggcccggccctg
ggcgctggcattgagcgcatgggcctggccatgggtggcggtggcggtgccagctttgac
cgtgccatcgagatggagcgtggcaacttcggaggaagcttcgcaggttcctttggtgga
gctggaggccatgctcctggggtggccaggaaggcctgccagatatttgtgagaaatctg
ccattcgatttcacatggaagatgctaaaggacaaattcaacgagtgcggccacgtgctg
tacgccgacatcaagatggagaatgggaagtccaaggggtgtggcgtggttaagttcgag
tcgccagaggtggccgagagagcctgccggatgatgaatggcatgaagctgagtggccga
gagattgacgttcgaattgatagaaacgcttaa

KEGG   Homo sapiens (human): 494115Help
Entry
494115            CDS       T01001                                 

Gene name
RBMXL1, RBM1
Definition
(RefSeq) RBMX like 1
  KO
K12885  heterogeneous nuclear ribonucleoprotein G
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    494115 (RBMXL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    494115 (RBMXL1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    494115 (RBMXL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RBM1CTR RRM_7 RRM_occluded RRM_5 PHM7_cyt
Motif
Other DBs
NCBI-GeneID: 494115
NCBI-ProteinID: NP_001156008
HGNC: 25073
Ensembl: ENSG00000213516
Vega: OTTHUMG00000010661
Pharos: Q96E39(Tdark)
UniProt: Q96E39
Position
1p22.2
AA seq 390 aa AA seqDB search
MVEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPA
DAKDAARDMNGKSLDGKAIKVEQATKPSFERGRHGPPPPPRSRGPPRGFGAGRGGSGGTR
GPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPSPKRSAPSGLVRSSSGMGGR
APLSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRD
YTYRDYGHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPLTRGP
PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSCDRVGRQERGLPPSVERGYPSSR
DSYSSSSRGAPRGAGPGGSRSDRGGGRSRY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagcagatcgcccaggaaagctcttcattggtgggcttaatacggaaacaaat
gagaaagctcttgaaacagtatttggcaaatatggacgaatagtggaagtactcttgata
aaagaccgtgaaaccaacaaatcaagaggatttgcttttgtcacctttgaaagcccagca
gacgctaaggatgcagccagagacatgaatggaaagtcattagatggaaaagccatcaag
gtggaacaagccaccaaaccatcatttgaaagaggtagacatggaccgcccccacctcca
agaagtagaggtcctccaagaggttttggagctggaagaggaggaagtggaggaaccagg
ggacctccttcacgaggaggacacatggatgatggtggatattccatgaattttaacatg
agttcttccaggggaccactcccagtaaaaagaggaccaccaccaagaagtgggggtcct
tctcctaagagatctgcaccttcaggactagttcgcagcagcagtggaatgggaggaaga
gctcctctatcacgtggaagagatagttatggaggtccacctcgaagggaaccgctcccc
tctcgtagagatgtttatttgtccccaagagatgatgggtattctactaaagacagctat
tcaagcagagattacccaagttctcgtgatacaagagattatgcaccaccaccacgagat
tatacttaccgtgattatggtcattccagttcacgtgatgactatccatcaagaggctat
ggcgatagagatggatatggtcgtgatcgtgactattcagatcatccaagtggaggttcc
tacagagattcatatgagagttatggtaactcacgtagtgctccacttacacgagggccc
ccgccatcttatggtggaagcagtcgctatgatgattatagcagctcacgtgatggatat
ggtggaagtcgagacagttactcaagcagccgaagtgatctctactcaagttgtgacagg
gttggcagacaagaaagagggcttcccccttctgtagaaagggggtacccttcttcacgt
gattcctacagcagttcaagccgcggagcaccaagaggtgctggccctggaggaagccga
tctgatagagggggaggcagaagcagatactag

KEGG   Homo sapiens (human): 5093Help
Entry
5093              CDS       T01001                                 

Gene name
PCBP1, HEL-S-85, HNRPE1, HNRPX, hnRNP-E1, hnRNP-X
Definition
(RefSeq) poly(rC) binding protein 1
  KO
K12889  poly(rC)-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    5093 (PCBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    5093 (PCBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    5093 (PCBP1)
   03041 Spliceosome [BR:hsa03041]
    5093 (PCBP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5093 (PCBP1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    5093 (PCBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KH_1 KH_2 KH_4 KH_5 Bac_chlorC
Motif
Other DBs
NCBI-GeneID: 5093
NCBI-ProteinID: NP_006187
OMIM: 601209
HGNC: 8647
Ensembl: ENSG00000169564
Vega: OTTHUMG00000129645
Pharos: Q15365(Tbio)
UniProt: Q15365 Q53SS8
Structure
PDB: 

Position
2p13.3
AA seq 356 aa AA seqDB search
MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIIT
LTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMT
IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQ
VARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGA
NINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggatgccggtgtgactgaaagtggactaaatgtgactctcaccattcggcttcttatg
cacggaaaggaagtaggaagcatcattgggaagaaaggggagtcggttaagaggatccgc
gaggagagtggcgcgcggatcaacatctcggaggggaattgtccggagagaatcatcact
ctgaccggccccaccaatgccatctttaaggctttcgctatgatcatcgacaagctggag
gaagatatcaacagctccatgaccaacagtaccgcggccagcaggcccccggtcaccctg
aggctggtggtgccggccacccagtgcggctccctgattgggaaaggcgggtgtaagatc
aaagagatccgcgagagtacgggggcgcaggtccaggtggcgggggatatgctgcccaac
tccaccgagcgggccatcaccatcgctggcgtgccgcagtctgtcaccgagtgtgtcaag
cagatttgcctggtcatgctggagacgctctcccagtctccgcaagggagagtcatgacc
attccgtaccagcccatgccggccagctccccagtcatctgcgcgggcggccaagatcgg
tgcagcgacgctgcgggctacccccatgccacccatgacctggagggaccacctctagat
gcctactcgattcaaggacaacacaccatttctccgctcgatctggccaagctgaaccag
gtggcaagacaacagtctcactttgccatgatgcacggcgggaccggattcgccggaatt
gactccagctctccagaggtgaaaggctattgggcaagtttggatgcatctactcaaacc
acccatgaactcaccattccaaataacttaattggctgcataatcgggcgccaaggcgcc
aacattaatgagatccgccagatgtccggggcccagatcaaaattgccaacccagtggaa
ggctcctctggtaggcaggttactatcactggctctgctgccagtattagtctggcccag
tatctaatcaatgccaggctttcctctgagaagggcatggggtgcagctag

DBGET integrated database retrieval system