KEGG   Homo sapiens (human): 145270Help
Entry
145270            CDS       T01001                                 

Gene name
PRIMA1, PRIMA
Definition
(RefSeq) proline rich membrane anchor 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PRIMA1 Cadherin_C_2 SRTM1 CAP_N
Motif
Other DBs
NCBI-GeneID: 145270
NCBI-ProteinID: NP_821092
OMIM: 613851
HGNC: 18319
Ensembl: ENSG00000175785
Vega: OTTHUMG00000141313
Pharos: Q86XR5(Tbio)
UniProt: Q86XR5 A0A024R6J9
Position
14q32.12
AA seq 153 aa AA seqDB search
MLLRDLVLRRGCCWSSLLLHCALHPLWGFVQVTHGEPQKSCSKVTDSCRHVCQCRPPPPL
PPPPPPPPPPRLLSAPAPNSTSCPTEESWWSGLVIIIAVCCASLVFLTVLVIICYKAIKR
KPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgctcctccgggacttggtgctgcgccgtggctgctgctggtcctcgctgctgctgcac
tgcgcgctccacccgctctggggcttcgtgcaggtgacgcatggtgagccccagaagtcc
tgctccaaagtgactgacagctgccgacacgtctgccagtgccggccccctcccccgctg
cccccgccgcccccacccccgccacctcccagactcctctccgccccagctcccaactct
acctcttgccccactgaggaaagctggtggtcggggctggtgatcatcattgccgtatgc
tgtgcctccctggtgtttctgactgtgcttgtcatcatttgctacaaagccataaaaagg
aaaccactgagaaaagacgaaaatggcaccagcgttgctgagtatcccatgagtgcttcg
cagagcaacaaaggagtagacgtgaacaacgcagtggtgtga

DBGET integrated database retrieval system