KEGG   Homo sapiens (human): 1453Help
Entry
1453              CDS       T01001                                 

Gene name
CSNK1D, ASPS, CKI-delta, CKId, CKIdelta, FASPS2, HCKID
Definition
(RefSeq) casein kinase 1 delta
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04540  Gap junction
hsa04710  Circadian rhythm
Disease
H00688  Familial advanced sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    1453 (CSNK1D)
   04390 Hippo signaling pathway
    1453 (CSNK1D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    1453 (CSNK1D)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    1453 (CSNK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1453 (CSNK1D)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1453 (CSNK1D)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1453 (CSNK1D)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1453 (CSNK1D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    1453 (CSNK1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Motif
Other DBs
NCBI-GeneID: 1453
NCBI-ProteinID: NP_001884
OMIM: 600864
HGNC: 2452
Ensembl: ENSG00000141551
Vega: OTTHUMG00000178601
Pharos: P48730(Tchem)
UniProt: P48730
Structure
PDB: 

Position
17q25.3
AA seq 415 aa AA seqDB search
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggagctgagagtcgggaacaggtaccggctgggccggaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcaggagaagaggttgccatcaagcttgaa
tgtgtcaaaaccaaacaccctcagctccacattgagagcaaaatctacaagatgatgcag
ggaggagtgggcatccccaccatcagatggtgcggggcagagggggactacaacgtcatg
gtgatggagctgctggggccaagcctggaggacctcttcaacttctgctccaggaaattc
agcctcaaaaccgtcctgctgcttgctgaccaaatgatcagtcgcatcgaatacattcat
tcaaagaacttcatccaccgggatgtgaagccagacaacttcctcatgggcctggggaag
aagggcaacctggtgtacatcatcgacttcgggctggccaagaagtaccgggatgcacgc
acccaccagcacatcccctatcgtgagaacaagaacctcacggggacggcgcggtacgcc
tccatcaacacgcaccttggaattgaacaatcccgaagagatgacttggagtctctgggc
tacgtgctaatgtacttcaacctgggctctctcccctggcaggggctgaaggctgccacc
aagagacagaaatacgaaaggattagcgagaagaaaatgtccacccccatcgaagtgttg
tgtaaaggctacccttccgaatttgccacatacctgaatttctgccgttccttgcgtttt
gacgacaagcctgactactcgtacctgcggcagcttttccggaatctgttccatcgccag
ggcttctcctatgactacgtgttcgactggaacatgctcaaatttggtgccagccgggcc
gccgatgacgccgagcgggagcgcagggaccgagaggagcggctgagacactcgcggaac
ccggctacccgcggcctcccttccacagcctccggccgcctgcgggggacgcaggaagtg
gctccccccacacccctcacccctacctcacacacggctaacacctccccccggcccgtc
tccggcatggagagagagcggaaagtgagtatgcggctgcaccgcggggcccccgtcaac
atctcctcgtccgacctcacaggccgacaagatacctctcgcatgtccacctcacagatt
cctggtcgggtggcttccagtggtcttcagtctgtcgtgcaccgatga

DBGET integrated database retrieval system