KEGG   Homo sapiens (human): 1454Help
Entry
1454              CDS       T01001                                 

Gene name
CSNK1E, CKIe, CKIepsilon, HCKIE
Definition
(RefSeq) casein kinase 1 epsilon
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
hsa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    1454 (CSNK1E)
   04340 Hedgehog signaling pathway
    1454 (CSNK1E)
   04390 Hippo signaling pathway
    1454 (CSNK1E)
   04392 Hippo signaling pathway - multiple species
    1454 (CSNK1E)
   04068 FoxO signaling pathway
    1454 (CSNK1E)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    1454 (CSNK1E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1454 (CSNK1E)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1454 (CSNK1E)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1454 (CSNK1E)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1454 (CSNK1E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    1454 (CSNK1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Motif
Other DBs
NCBI-GeneID: 1454
NCBI-ProteinID: NP_001885
OMIM: 600863
HGNC: 2453
Ensembl: ENSG00000213923
Vega: OTTHUMG00000151135
Pharos: P49674(Tchem)
UniProt: P49674 Q5U045
Structure
PDB: 

Position
22q13.1
AA seq 416 aa AA seqDB search
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggagctacgtgtggggaacaagtaccgcctgggacggaagatcgggagcgggtccttc
ggagatatctacctgggtgccaacatcgcctctggtgaggaagtcgccatcaagctggag
tgtgtgaagacaaagcacccccagctgcacatcgagagcaagttctacaagatgatgcag
ggtggcgtggggatcccgtccatcaagtggtgcggagctgagggcgactacaacgtgatg
gtcatggagctgctggggcctagcctcgaggacctgttcaacttctgttcccgcaaattc
agcctcaagacggtgctgctcttggccgaccagatgatcagccgcatcgagtatatccac
tccaagaacttcatccaccgggacgtcaagcccgacaacttcctcatggggctggggaag
aagggcaacctggtctacatcatcgacttcggcctggccaagaagtaccgggacgcccgc
acccaccagcacattccctaccgggaaaacaagaacctgaccggcacggcccgctacgct
tccatcaacacgcacctgggcattgagcaaagccgtcgagatgacctggagagcctgggc
tacgtgctcatgtacttcaacctgggctccctgccctggcaggggctcaaagcagccacc
aagcgccagaagtatgaacggatcagcgagaagaagatgtcaacgcccatcgaggtcctc
tgcaaaggctatccctccgaattctcaacatacctcaacttctgccgctccctgcggttt
gacgacaagcccgactactcttacctacgtcagctcttccgcaacctcttccaccggcag
ggcttctcctatgactacgtctttgactggaacatgctgaaattcggtgcagcccggaat
cccgaggatgtggaccgggagcggcgagaacacgaacgcgaggagaggatggggcagcta
cgggggtccgcgacccgagccctgccccctggcccacccacgggggccactgccaaccgg
ctccgcagtgccgccgagcccgtggcttccacgccagcctcccgcatccagccggctggc
aatacttctcccagagcgatctcgcgggtcgaccgggagaggaaggtgagtatgaggctg
cacaggggtgcgcccgccaacgtctcctcctcagacctcactgggcggcaagaggtctcc
cggatcccagcctcacagacaagtgtgccatttgaccatctcgggaagtga

DBGET integrated database retrieval system