KEGG   Homo sapiens (human): 1454
Entry
1454              CDS       T01001                                 

Gene name
CSNK1E, CKIe, CKIepsilon, HCKIE
Definition
(RefSeq) casein kinase 1 epsilon
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
hsa04710  Circadian rhythm
hsa05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    1454 (CSNK1E)
   04340 Hedgehog signaling pathway
    1454 (CSNK1E)
   04390 Hippo signaling pathway
    1454 (CSNK1E)
   04392 Hippo signaling pathway - multiple species
    1454 (CSNK1E)
   04068 FoxO signaling pathway
    1454 (CSNK1E)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    1454 (CSNK1E)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1454 (CSNK1E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1454 (CSNK1E)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1454 (CSNK1E)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1454 (CSNK1E)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1454 (CSNK1E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    1454 (CSNK1E)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 1454
NCBI-ProteinID: NP_001885
OMIM: 600863
HGNC: 2453
Ensembl: ENSG00000213923
Vega: OTTHUMG00000151135
Pharos: P49674(Tchem)
UniProt: P49674 Q5U045
Structure
PDB: 
4HNI 4HOK

Position
22q13.1
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagctacgtgtggggaacaagtaccgcctgggacggaagatcgggagcgggtccttc
ggagatatctacctgggtgccaacatcgcctctggtgaggaagtcgccatcaagctggag
tgtgtgaagacaaagcacccccagctgcacatcgagagcaagttctacaagatgatgcag
ggtggcgtggggatcccgtccatcaagtggtgcggagctgagggcgactacaacgtgatg
gtcatggagctgctggggcctagcctcgaggacctgttcaacttctgttcccgcaaattc
agcctcaagacggtgctgctcttggccgaccagatgatcagccgcatcgagtatatccac
tccaagaacttcatccaccgggacgtcaagcccgacaacttcctcatggggctggggaag
aagggcaacctggtctacatcatcgacttcggcctggccaagaagtaccgggacgcccgc
acccaccagcacattccctaccgggaaaacaagaacctgaccggcacggcccgctacgct
tccatcaacacgcacctgggcattgagcaaagccgtcgagatgacctggagagcctgggc
tacgtgctcatgtacttcaacctgggctccctgccctggcaggggctcaaagcagccacc
aagcgccagaagtatgaacggatcagcgagaagaagatgtcaacgcccatcgaggtcctc
tgcaaaggctatccctccgaattctcaacatacctcaacttctgccgctccctgcggttt
gacgacaagcccgactactcttacctacgtcagctcttccgcaacctcttccaccggcag
ggcttctcctatgactacgtctttgactggaacatgctgaaattcggtgcagcccggaat
cccgaggatgtggaccgggagcggcgagaacacgaacgcgaggagaggatggggcagcta
cgggggtccgcgacccgagccctgccccctggcccacccacgggggccactgccaaccgg
ctccgcagtgccgccgagcccgtggcttccacgccagcctcccgcatccagccggctggc
aatacttctcccagagcgatctcgcgggtcgaccgggagaggaaggtgagtatgaggctg
cacaggggtgcgcccgccaacgtctcctcctcagacctcactgggcggcaagaggtctcc
cggatcccagcctcacagacaagtgtgccatttgaccatctcgggaagtga

DBGET integrated database retrieval system