KEGG   Homo sapiens (human): 1455
Entry
1455              CDS       T01001                                 

Gene name
CSNK1G2, CK1g2
Definition
(RefSeq) casein kinase 1 gamma 2
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    1455 (CSNK1G2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1455 (CSNK1G2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1455 (CSNK1G2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1455 (CSNK1G2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr CK1gamma_C Pkinase_fungal PIP49_C DUF3580
Other DBs
NCBI-GeneID: 1455
NCBI-ProteinID: NP_001310
OMIM: 602214
HGNC: 2455
Ensembl: ENSG00000133275
Vega: OTTHUMG00000180016
Pharos: P78368(Tchem)
UniProt: P78368
Structure
PDB: 
2C47

Position
19p13.3
AA seq 415 aa
MDFDKKGGKGETEEGRRMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKR
QHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSK
NQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggattttgacaagaaaggagggaaaggggagacggaggagggccggagaatgtccaag
gccggcgggggccggagcagccacggcatccggagctcggggaccagctcgggggtcctg
atggtgggccccaacttccgcgtcggcaagaagatcggctgcggcaacttcggggagctc
cgcctaggaaagaatctctatacaaatgaatacgtggctatcaaattggagccgatcaag
tcccgggccccgcagctgcacctggagtaccggttctacaagcagctcagcgccacagag
ggcgtccctcaggtctactacttcggtccgtgcgggaagtacaacgccatggtgctggag
ctgctggggcccagcctggaggacctgttcgacctgtgcgaccggaccttcacgctcaag
acggtgctgatgatcgccatccagctgatcacgcgcatggagtatgtgcacaccaagagc
ctaatctaccgggacgtgaagcccgagaacttcctggtgggccgcccggggaccaagcgg
cagcatgccatccacatcatcgacttcgggctggccaaggagtacatcgaccccgagacc
aagaagcacatcccgtaccgcgagcacaagagcctgacgggcacggcgcgctacatgagc
atcaacacgcacctgggcaaggagcagagccgccgcgacgacctggaggcgctgggccac
atgttcatgtacttcctgcgcggcagcctcccctggcaggggctcaaggccgacacgctc
aaggagcggtaccagaagatcggggacaccaaacgcgccacgcccatcgaggtgctctgc
gagaacttcccagaggagatggccacgtacctgcgctatgtgcggcgcctggacttcttc
gagaagcccgactatgactacctgcggaagctcttcaccgacctcttcgaccgcagtggc
ttcgtgttcgactatgagtacgactgggccgggaagcccctgccgacccccatcggcacc
gtccacaccgacctgccctcccagcctcagctccgggacaaaacccagccgcacagcaaa
aaccaggcgttgaactccaccaacggggagctgaatgcggacgaccccacggccggccac
tccaacgccccgatcacagcgcctgcagaggtggaggtggccgatgaaaccaaatgctgc
tgtttcttcaagaggagaaagagaaaatcgctgcagcgacacaagtga

DBGET integrated database retrieval system