KEGG   Homo sapiens (human): 145567Help
Entry
145567            CDS       T01001                                 

Gene name
TTC7B, TTC7L1, c14_5685
Definition
(RefSeq) tetratricopeptide repeat domain 7B
  KO
K21843  tetratricopeptide repeat protein 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    145567 (TTC7B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    145567 (TTC7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_8 TPR_19 TPR_14 ANAPC3 TPR_16 TPR_1 TPR_12 TPR_17 TPR_11 TPR_15 TPR_9 TPR_10 TPR_20 DUF3808 NARP1
Motif
Other DBs
NCBI-GeneID: 145567
NCBI-ProteinID: NP_001010854
HGNC: 19858
Ensembl: ENSG00000165914
Vega: OTTHUMG00000171047
Pharos: Q86TV6(Tdark)
UniProt: Q86TV6 Q6PIF1
Structure
PDB: 

Position
14q32.11
AA seq 843 aa AA seqDB search
MATKKAGSRLETEIERCRSECQWERIPELVKQLSAKLIANDDMAELLLGESKLEQYLKEH
PLRQGASPRGPKPQLTEVRKHLTAALDRGNLKSEFLQESNLIMAKLNYVEGDYKEALNIY
ARVGLDDLPLTAVPPYRLRVIAEAYATKGLCLEKLPISSSTSNLHVDREQDVITCYEKAG
DIALLYLQEIERVILSNIQNRSPKPGPAPHDQELGFFLETGLQRAHVLYFKNGNLTRGVG
RFRELLRAVETRTTQNLRMTIARQLAEILLRGMCEQSYWNPLEDPPCQSPLDDPLRKGAN
TKTYTLTRRARVYSGENIFCPQENTEEALLLLLISESMANRDAVLSRIPEHKSDRLISLQ
SASVVYDLLTIALGRRGQYEMLSECLERAMKFAFEEFHLWYQFALSLMAAGKSARAVKVL
KECIRLKPDDATIPLLAAKLCMGSLHWLEEAEKFAKTVVDVGEKTSEFKAKGYLALGLTY
SLQATDASLRGMQEVLQRKALLAFQRAHSLSPTDHQAAFYLALQLAISRQIPEALGYVRQ
ALQLQGDDANSLHLLALLLSAQKHYHDALNIIDMALSEYPENFILLFSKVKLQSLCRGPD
EALLTCKHMLQIWKSCYNLTNPSDSGRGSSLLDRTIADRRQLNTITLPDFSDPETGSVHA
TSVAASRVEQALSEVASSLQSSAPKQGPLHPWMTLAQIWLHAAEVYIGIGKPAEATACTQ
EAANLFPMSHNVLYMRGQIAELRGSMDEARRWYEEALAISPTHVKSMQRLALILHQLGRY
SLAEKILRDAVQVNSTAHEVWNGLGEVLQAQGNDAAATECFLTALELEASSPAVPFTIIP
RVL
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaagaaggcaggctcgcggctggagacggagatcgagcgctgccgctccgag
tgccagtgggagcggatccctgagctcgtcaagcagctgtcggccaagctcatcgccaac
gatgacatggcagagcttctcctcggggagtcgaagctggagcagtacctgaaggaacac
cccctgaggcagggggccagtccccgaggccccaagccccagctgactgaggtccgcaag
catctgaccgccgccctggaccgagggaaccttaagtcagaattcctacaagaatccaat
ctgatcatggccaagttgaattatgtggaaggtgattataaagaagctctgaacatttac
gcccgggtgggcctggacgatctgccactgacagctgtcccgccctacaggctgcgggtg
atcgcagaagcctacgctaccaaaggactttgtttggagaagctgcctatttcttcttct
accagtaatctccatgtggaccgggaacaggatgtcatcacctgttatgagaaagcaggg
gacatcgcactcctgtatctccaagagatagaaagggtaatactttctaatattcaaaac
agaagccctaagcctggccctgctccccacgatcaagaactaggttttttcctagaaaca
ggacttcagagagcccatgtcctctatttcaaaaatgggaacttgacaagaggagtcgga
agatttagagagcttctcagagcagttgaaacaagaacgactcaaaacctgcgaatgaca
atagccaggcagctggcagagatcttgttgcggggtatgtgtgagcagagctactggaac
cctctggaggatccaccgtgccagtcacctctggacgatcctctccgcaaaggagcaaac
acaaaaacctacactctcactcggagagcccgtgtctactcaggagagaacattttttgt
cctcaagaaaatacggaagaagccctgttgttattgctgattagtgaatcaatggccaac
cgggacgctgtgctgagcaggatacctgaacacaagagtgaccgcctcatcagtctgcag
agtgcatctgtggtctatgacttactcaccattgctcttggaagaagaggccagtatgag
atgctgtcagagtgcctagaaagagccatgaagtttgcctttgaggaattccacctgtgg
taccagtttgctctgtccctgatggctgctggaaaatctgcccgtgccgtgaaggtgctg
aaagagtgtatccgcctgaagccagacgatgccaccatccctctcctcgctgccaagctc
tgcatgggctccctgcactggttggaagaggctgaaaagtttgccaaaactgtcgttgat
gtgggagagaaaacgtcagagttcaaggccaaaggctacttagctctggggctcacgtac
agtctgcaggccactgacgcttctttgcgagggatgcaggaggtcctacagagaaaggcg
cttcttgcatttcagagggcccacagcctgtcacccacagatcaccaagcagctttctac
ctggctctgcagcttgccatctccagacagatcccagaggctctggggtatgtccgccaa
gctcttcagcttcaaggtgacgatgccaactccctgcacctccttgccctcctgctgtca
gcacagaagcattaccatgacgctctgaacatcatcgacatggccctgagtgaataccca
gaaaatttcatactactgttttccaaagtgaagttgcagtcactctgccgaggcccggac
gaggcactgctgacttgtaagcacatgctgcagatatggaaatcctgctacaacctcacc
aaccccagtgattctggacgtgggagcagcctcttagatagaaccattgctgacagacga
cagcttaatacaattactttgccagacttcagcgatcccgagacaggctccgtccatgcc
acatcggtagcagcctcaagagtggagcaggcactgtcggaagtggcttcgtctctgcag
agcagtgcccctaagcagggcccgctgcacccctggatgacgctggcacagatctggctc
catgcagctgaagtctatatcggcatcgggaagcctgcagaagccacagcctgtacccaa
gaagctgccaacctcttcccaatgtcccacaatgtcctctacatgcgcggccagattgct
gagctccggggaagcatggacgaggcgcggcggtggtatgaagaggccttagccatcagc
cccacccacgtgaagagcatgcagcgactggccctgatccttcaccagctaggccgctac
agtctggcggagaagatcctccgggacgcggtgcaggtgaactcgacagcccacgaggtc
tggaacgggctgggcgaggtcctccaagctcagggcaacgatgcggcggctacggagtgc
ttcctgacagccttggagctggaggccagcagccccgccgtgcccttcaccatcatcccc
cgcgtgctctga

DBGET integrated database retrieval system