KEGG   Homo sapiens (human): 145773
Entry
145773            CDS       T01001                                 
Symbol
FAM81A
Name
(RefSeq) family with sequence similarity 81 member A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: tRNA_bind_3
Other DBs
NCBI-GeneID: 145773
NCBI-ProteinID: NP_689663
HGNC: 28379
Ensembl: ENSG00000157470
Pharos: Q8TBF8(Tdark)
UniProt: Q8TBF8
Position
15:59397981..59523555
AA seq 368 aa
MENMHLRRVRTMPRHSQSLTMAPYSSVSLVEQLEDRILCHEKTTAALVEHAFRIKDDIVN
SLQKMQNKGGGDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKT
LEMRQLSGLGDLRGRVARCDASIARLSAEHKTTYEGLQHLNKEQQAAKLILETKIKDAEG
QISQLLNRVDLSISEQSTKLKMSHRDSNHQLQLLDTKFKGTVEELSNQILSARSWLQQEQ
ERIEKELLQKIDQLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEE
EKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLDRDQLQKQIQL
MQKPETPM
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggaaaatatgcatctaaggcgagtgagaaccatgccccgacacagccagtccctgacc
atggcaccatactcatctgtaagcctcgtggagcagctggaagacaggatcctctgccat
gagaaaaccaccgccgccctcgtagagcacgcctttcggattaaagatgacattgtcaac
agtttgcagaaaatgcaaaacaaagggggaggtgaccgcttggccaggcttttcttggag
gagcatatcagaaacataactgccatagtgaagcaacttaatcgggatatcgaggtactc
caggagcagattcgtgcccgggacaacattagctatggaactaattctgccttaaagacc
ctggagatgcgccagctctccggtttgggagatcttcgaggaagagtggcaagatgtgat
gccagcatagctagactttctgcagagcacaaaacgacctatgaggggctccagcacttg
aacaaagaacagcaggctgccaaacttatcttggaaacgaaaatcaaagatgcagaggga
cagatttctcagcttttgaacagagtggacttgtcaatatcagagcagagcaccaaactg
aagatgtctcacagagacagtaaccaccagcttcagcttttggacactaaatttaaaggt
acagttgaggaactcagtaaccagatattatctgcacggagttggttgcaacaggaacaa
gaacggatagaaaaagagcttttacagaaaattgatcagctttccttgattgttaaggaa
aacagtggagccagtgaaagggatatggagaagaagctcagccagatgtcagccaggctt
gacaaaatagaagagggtcaaaagaagacttttgatggtcagagaacaaggcaagaagag
gagaagatgcacgggcgaatcaccaagctggagttacagatgaaccagaacatcaaggaa
atgaaagcagaagttaatgctgggtttacagccgtctatgaaagcataggatccctcagg
caagttctcgaggccaagatgaagctggacagggaccagctacagaagcaaatccagctg
atgcagaagccagagacccccatgtga

DBGET integrated database retrieval system