KEGG   Homo sapiens (human): 145814Help
Entry
145814            CDS       T01001                                 

Gene name
PGPEP1L
Definition
(RefSeq) pyroglutamyl-peptidase I like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C15 PgaPase_1
Motif
Other DBs
NCBI-GeneID: 145814
NCBI-ProteinID: NP_001096082
HGNC: 27080
Ensembl: ENSG00000183571
Vega: OTTHUMG00000171896
Pharos: A6NFU8(Tdark)
UniProt: A6NFU8
Position
15q26.3
AA seq 196 aa AA seqDB search
MKPRTLVELSKLGLGNETVVQLRTLELPVDYREAKRRVTGIWEDHQPQLVVHVGMDTAAK
AIILEQSGKNQGYRDADIRSFWPEGGVCLPGSPDVLESGVCMKAVCKRVAVEGVDVIFSR
DAGRYVCDYTYYLSLHHGKGCAALIHVPPLSRGLPASLLGRALRVIIQEMLEEVGKPKHR
AQFEENSTMVLPAKGN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcggactctcgtggagctctccaagctgggcctggggaatgaaacagtggtg
cagctgcggactctggagctgcctgtagattacagggaggctaagcggagggtcaccgga
atctgggaagatcatcagccgcaactcgtcgtgcatgtgggcatggacaccgccgccaag
gcgatcattctggaacagtctggcaagaaccaaggctaccgggacgccgacatccgcagc
ttctggcccgagggcggcgtgtgcctacctggcagcccagacgtgctggagtcaggggtc
tgcatgaaggcagtctgcaagcgcgtagctgtggagggtgtcgacgtgatcttttcccga
gatgcaggcagatacgtctgtgattatacctattacctgtctctgcatcatggaaagggc
tgcgcggcactcatccatgtccctccactatcgcgcgggctcccggccagcctgctggga
agagccttgagagtcatcatccaggaaatgctggaagaggtgggaaagcccaagcacaga
gcccagttcgaagaaaactcaaccatggtccttccagccaaagggaactga

DBGET integrated database retrieval system