KEGG   Homo sapiens (human): 145853
Entry
145853            CDS       T01001                                 
Symbol
C15orf61
Name
(RefSeq) chromosome 15 open reading frame 61
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4528
Other DBs
NCBI-GeneID: 145853
NCBI-ProteinID: NP_001137408
HGNC: 34453
Ensembl: ENSG00000189227
Vega: OTTHUMG00000172248
Pharos: A6NNL5(Tdark)
UniProt: A6NNL5
Position
15:67521131..67530146
AA seq 157 aa
MEALRRAHEVALRLLLCRPWASRAAARPKPSASEVLTRHLLQRRLPHWTSFCVPYSAVRN
DQFGLSHFNWPVQGANYHVLRTGCFPFIKYHCSKAPWQDLARQNRFFTALKVVNLGIPTL
LYGLGSWLFARVTETVHTSYGPITVYFLNKEDEGAMY
NT seq 474 nt   +upstreamnt  +downstreamnt
atggaggccctgaggagggcccacgaggtcgcgctccgcctgctgctgtgtaggccgtgg
gcctcgcgcgccgccgcccgccccaagcccagcgcctcggaggtgctgacgcggcatctg
ctgcagcggcgcctgccgcactggacctccttctgcgtgccctacagcgccgtccgcaac
gaccagttcggcctctcgcacttcaactggccggtgcagggcgccaactaccacgtcctg
cgcaccggctgcttccccttcatcaagtaccactgctccaaggctccctggcaggacctg
gcccggcagaaccgcttcttcacggcgctcaaggtcgtcaacctcggtattccaacttta
ttatatggacttggctcctggttatttgccagagtcacagagactgtgcataccagttat
ggacccataacagtttattttctcaataaagaagatgaaggtgccatgtattga

DBGET integrated database retrieval system