KEGG   Homo sapiens (human): 1460Help
Entry
1460              CDS       T01001                                 

Gene name
CSNK2B, CK2B, CK2N, CSK2B, Ckb1, Ckb2, G5A
Definition
(RefSeq) casein kinase 2 beta
  KO
K03115  casein kinase II subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa04064  NF-kappa B signaling pathway
hsa04137  Mitophagy - animal
hsa04310  Wnt signaling pathway
hsa04520  Adherens junction
hsa05162  Measles
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    1460 (CSNK2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    1460 (CSNK2B)
   04064 NF-kappa B signaling pathway
    1460 (CSNK2B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    1460 (CSNK2B)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    1460 (CSNK2B)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05162 Measles
    1460 (CSNK2B)
   05168 Herpes simplex infection
    1460 (CSNK2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    1460 (CSNK2B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    1460 (CSNK2B)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   Kinase
    1460 (CSNK2B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     1460 (CSNK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CK_II_beta CCDC24
Motif
Other DBs
NCBI-GeneID: 1460
NCBI-ProteinID: NP_001311
OMIM: 115441
HGNC: 2460
Ensembl: ENSG00000204435
Vega: OTTHUMG00000177888
Pharos: P67870(Tbio)
UniProt: P67870 N0E4C7
Structure
PDB: 

Position
6p21.33
AA seq 215 aa AA seqDB search
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa
ttcttctgtgaagtggatgaagactacatccaggacaaatttaatcttactggactcaat
gagcaggtccctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa
gaactggaagacaaccccaaccagagtgacctgattgagcaggcagccgagatgctttat
ggattgatccacgcccgctacatccttaccaaccgtggcatcgcccagatgttggaaaag
taccagcaaggagactttggttactgtcctcgtgtgtactgtgagaaccagccaatgctt
cccattggcctttcagacatcccaggtgaagccatggtgaagctctactgccccaagtgc
atggatgtgtacacacccaagtcatcaagacaccatcacacggatggcgcctacttcggc
actggtttccctcacatgctcttcatggtgcatcccgagtaccggcccaagagacctgcc
aaccagtttgtgcccaggctctacggtttcaagatccatccgatggcctaccagctgcag
ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system