KEGG   Homo sapiens (human): 146059
Entry
146059            CDS       T01001                                 
Symbol
CDAN1, CDA1, CDAI, CDAN1A, DLT, PRO1295
Name
(RefSeq) codanin 1
  KO
K19531  codanin-1
Organism
hsa  Homo sapiens (human)
Disease
H00917  Congenital dyserythropoietic anemias (CDAs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    146059 (CDAN1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     146059 (CDAN1)
SSDB
Motif
Pfam: Codanin-1_C DUF5743
Other DBs
NCBI-GeneID: 146059
NCBI-ProteinID: NP_612486
OMIM: 607465
HGNC: 1713
Ensembl: ENSG00000140326
Pharos: Q8IWY9(Tbio)
UniProt: Q8IWY9
Position
15:complement(42723544..42737128)
AA seq 1227 aa
MAAVLESLLREEVSVAAVVRWIARSTQGSEDNAGEAAALSSLRALRKEFVPFLLNFLREQ
SSRVLPQGPPTPAKTPGASAALPGRPGGPPRGSRGARSQLFPPTEAQSTAAEAPLARRGG
RRRGPGPARERGGRGLEEGVSGESLPGAGGRRLRGSGSPSRPSLTLSDPPNLSNLEEFPP
VGSVPPGPTGTKPSRRINPTPVSEERSLSKPKTCFTSPPISCVPSSQPSALDTSPWGLGL
PPGCRSLQEEREMLRKERSKQLQQSPTPTCPTPELGSPLPSRTGSLTDEPADPARVSSRQ
RLELVALVYSSCIAENLVPNLFLELFFVFQLLTARRMVTAKDSDPELSPAVLDSLESPLF
QSIHDCVFFAVQVLECHFQVLSNLDKGTLKLLAENERLLCFSPALQGRLRAAYEGSVAKV
SLVMPPSTQAVSFQPETDNRANFSSDRAFHTFKKQRDVFYEVLREWEDHHEEPGWDFEKG
LGSRIRAMMGQLSAACSHSHFVRLFQKQLLQMCQSPGGAGGTVLGEAPDVLSMLGADKLG
RLWRLQERLMAPQSSGGPCPPPTFPGCQGFFRDFILSASSFQFNQHLMDSLSLKIQELNG
LALPQHEPNDEDGESDVDWQGERKQFAVVLLSLRLLAKFLGFVAFLPYRGPEPPPTGELQ
DSILALRSQVPPVLDVRTLLQRGLQARRAVLTVPWLVEFLSFADHVVPLLEYYRDIFTLL
LRLHRSLVLSQESEGKMCFLNKLLLLAVLGWLFQIPTVPEDLFFLEEGPSYAFEVDTVAP
EHGLDNAPVVDQQLLYTCCPYIGELRKLLASWVSGSSGRSGGFMRKITPTTTTSLGAQPS
QTSQGLQAQLAQAFFHNQPPSLRRTVEFVAERIGSNCVKHIKATLVADLVRQAESLLQEQ
LVTQGEEGGDPAQLLEILCSQLCPHGAQALALGREFCQRKSPGAVRALLPEETPAAVLSS
AENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGCSRACEHH
APLPSHLISEIKDVLSLAVGPRDPDEGVSPEHLEQLLGQLGQTLRCRQFLCPPAEQHLAK
CSVELASLLVADQIPILGPPAQYRLERGQARRLLHMLLSLWKEDFQGPVPLQLLLSPRNV
GLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFL
AEPHLPEPQLRACELVQPNRGTVLAQS
NT seq 3684 nt   +upstreamnt  +downstreamnt
atggcggccgttttggagtcgctgctgcgagaagaggtgtcggtcgcagccgtcgtgcgg
tggatcgcgcgcagcacccagggttcggaggataacgctggggaggcggccgcgctgagc
tcactccgggccctgcggaaagaattcgtaccgttcctgttgaacttcctgagggagcag
agcagccgcgtcctcccgcaggggcccccgacccccgccaagaccccgggcgcctcggca
gccttgccagggaggccgggaggcccgccgcggggtagccgcggggcgcgcagccagctt
ttccctccgaccgaggcccagagcaccgctgccgaggcccctctggcccgccgcgggggc
aggaggcggggcccggggccggcccgcgagcgtggaggccgcggcctggaggagggggtc
agcggggagagcctgcccggagccgggggccggaggcttaggggctctggcagccccagc
cgccccagcctcacgctgtctgatccgccaaacctcagcaacctggaggagttccctccc
gtaggctcggttccccccggccctacagggacgaagccttctcgcaggatcaacccaact
ccggtgagcgaagagcggtcactctccaagcccaagacctgcttcacctcacccccaatc
agctgtgtccccagttcccaaccctcagccctggacactagcccttggggccttggcctt
cccccagggtgcagaagtctgcaagaggagcgagagatgctcaggaaggagcgctctaag
cagctgcagcagtcacctacccccacctgtcccaccccagaattggggtcgcccctcccc
agccggacaggaagcctcacagatgaacctgcagaccctgccagagtgtcttcccgccag
cgcctggagcttgtagcccttgtttactcctcgtgcattgctgagaacctggtaccaaac
ctcttcttggagcttttcttcgtctttcagctcctcactgcccggaggatggtgactgcc
aaggacagcgaccctgaactaagtccagctgtcctagattccctggaaagtccactgttc
caaagcatccacgattgtgtcttctttgcagtgcaggttttggagtgtcactttcaggtt
ctttccaacctggacaaagggaccttgaagctgctggctgagaatgagcggctgctgtgc
ttctcaccagctctgcaaggccgccttcgagctgcctatgagggcagtgttgccaaggtc
tctctggtgatgcctccctctactcaagctgtctcctttcagccagagactgacaatcgt
gccaacttctccagtgaccgagcctttcatacttttaagaaacagagggatgtgttttat
gaggtgctgcgagagtgggaagatcaccatgaggagcctggctgggattttgagaagggc
ttgggcagcagaatcagggccatgatgggtcagctctccgcagcctgcagccacagccac
tttgttcggcttttccaaaaacaactactccagatgtgtcagagccctggtggtgctggg
ggcaccgtcttgggcgaggccccagatgtgttgagtatgctgggagctgacaagctgggg
cggttgtggcgcctacaggaacggcttatggctcctcagagcagtggggggccctgccca
ccccccaccttcccaggctgtcaaggcttctttagggacttcatccttagtgccagcagc
ttccagtttaaccagcatctcatggacagtctgagcttgaagatccaggagctcaatggt
cttgccctgccccagcatgagcccaatgatgaagacggggagtcagacgtagactggcag
ggtgagcggaagcaatttgctgtggtgcttcttagcctgagacttttggctaaattcctg
ggctttgtggctttcctgccataccgggggcctgaacctcccccgaccggtgagcttcag
gactccattctggccctcaggagccaggtccctccggtcctggatgtgcggactctgctg
cagcgagggctgcaggcccgccgggcggtgctcaccgtgccctggctggtggagtttctc
tcctttgctgaccatgttgttcccttgctggaatattaccgggacatcttcactctcctg
ctgcgcctgcaccggagcttggtgttgtcgcaggagagtgaggggaagatgtgtttcctg
aacaagctgctgctacttgctgtcctgggctggcttttccagattcccacagtccctgag
gacttgttctttctggaagagggtccctcatatgcctttgaggtggacacagtagcccca
gagcatggcttggacaatgcgcctgtggtggaccagcagctgctctacacctgctgcccc
tacatcggagagctccggaaactgctcgcttcgtgggtgtcaggcagtagtggacggagt
gggggcttcatgaggaaaatcacccccaccactaccaccagcctgggagcccagccttcc
cagaccagccaggggctgcaggcacagctcgcccaggcctttttccacaaccagccgccc
tccttgcgccggaccgtagagttcgtggcagaaagaattggatcaaactgtgtcaaacat
atcaaggctacactggtggcagatctggtgcgccaggcagagtcacttctccaagagcag
ctggtgacacagggagaggaagggggagacccagcccagctgttggagatcttgtgttcc
cagctgtgccctcacggggcccaggcattggccctggggcgggagttctgtcaaaggaag
agccctggggctgtgcgggcgctgcttccagaggagaccccggcagccgttctgagcagt
gcagagaacattgctgtggggcttgcaacagagaaagcctgtgcttggctgtcagccaac
atcacagcactgatcaggagggaggtgaaagcagcagtgagtcgcacacttcgagcccag
ggtcctgaacctgctgcccggggggagcggaggggctgctcccgcgcctgtgagcaccat
gctcccctcccctcccacctcatctccgagataaaagacgtgctctccttggccgtgggg
ccacgggaccctgacgagggagtctccccagagcatctggaacagctcctaggccagctg
ggccagacgctgcggtgccgccagttcctgtgcccacctgctgagcagcatctggcaaag
tgctctgtggagttagcttccctcctcgttgcagatcaaattcctatcctagggcccccg
gcacagtacaggctggagagagggcaggctcgaaggcttctgcacatgctgctttccttg
tggaaggaagactttcaggggccggttccgctgcagctgctgctgagcccaagaaatgtg
gggcttctggcagacacaaggccaagggagtgggacttgctgctattcttgctacgggag
ctggtggagaagggtctgatgggacggatggagatagaggcctgcctgggcagcctccac
caggcccagtggccaggggactttgctgaagaattagcaacactgtctaatctgtttcta
gccgagccccacctgccagaaccccagctaagagcctgtgagttggtgcagccaaaccgg
ggcactgtgctggcccagagctag

DBGET integrated database retrieval system