KEGG   Homo sapiens (human): 146225Help
Entry
146225            CDS       T01001                                 

Gene name
CMTM2, CKLFSF2
Definition
(RefSeq) CKLF like MARVEL transmembrane domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL GWT1
Motif
Other DBs
NCBI-GeneID: 146225
NCBI-ProteinID: NP_653274
OMIM: 607885
HGNC: 19173
Ensembl: ENSG00000140932
Vega: OTTHUMG00000137501
Pharos: Q8TAZ6(Tbio)
UniProt: Q8TAZ6
Position
16q21
AA seq 248 aa AA seqDB search
MAPKAAKGAKPEPAPAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEPSDKPQKAVQPKH
EVGTRRGCRRYRWELKDSNKEFWLLGHAEIKIRSLGCLIAAMILLSSLTVHPILRLIITM
EISFFSFFILLYSFAIHRYIPFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMNLHYLL
AVILIGAAGVFAFIDVCLQRNHFRGKKAKKHMLVPPPGKEKGPQQGKGPEPAKPPEPGKP
PGPAKGKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcacctaaggcggcaaagggggccaagccagagccagcaccagctccacctccaccc
ggggccaaacccgaggaagacaagaaggacggtaaggagccatcggacaaacctcaaaag
gcggtgcaggaccataaggagccatcggacaaacctcaaaaggcggtgcagcccaagcac
gaagtgggcacgaggagggggtgtcgccgctaccggtgggaattaaaagacagcaataaa
gagttctggctcttggggcacgctgagatcaagattcggagtttgggctgcctaatagct
gcaatgatactgttgtcctcactcaccgtgcaccccatcttgaggcttatcatcaccatg
gagatatccttcttcagcttcttcatcttactgtacagctttgccattcatagatacata
cccttcatcctgtggcccatttctgacctcttcaacgacctgattgcttgtgcgttcctt
gtgggagccgtggtctttgctgtgagaagtcggcgatccatgaatctccactacttactt
gctgtgatccttattggtgcggctggagtttttgcttttatcgatgtgtgtcttcaaaga
aaccacttcagaggcaagaaggccaaaaagcatatgctggttcctcctccaggaaaggaa
aaaggaccccagcagggcaagggaccagaacccgccaagccaccagaacctggcaagcca
ccagggccagcaaagggaaagaaatga

DBGET integrated database retrieval system