KEGG   Homo sapiens (human): 1463Help
Entry
1463              CDS       T01001                                 

Gene name
NCAN, CSPG3
Definition
(RefSeq) neurocan
  KO
K06794  neurocan core protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    1463 (NCAN)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1463 (NCAN)
   04091 Lectins [BR:hsa04091]
    1463 (NCAN)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   1463 (NCAN)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   1463 (NCAN)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   1463 (NCAN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xlink Lectin_C Sushi V-set EGF hEGF Ig_3 EGF_2
Motif
Other DBs
NCBI-GeneID: 1463
NCBI-ProteinID: NP_004377
OMIM: 600826
HGNC: 2465
Ensembl: ENSG00000130287
Vega: OTTHUMG00000182218
Pharos: O14594(Tbio)
UniProt: O14594 A0A024R7M3 Q4LE67
Position
19p13.11
AA seq 1321 aa AA seqDB search
MGAPFVWALGLLMLQMLLFVAGEQGTQDITDASERGLHMQKLGSGSVQAALAELVALPCL
FTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRR
ANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQE
ACRLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAERFDAYCFRAHH
PTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEETLILE
EKQESQQTLSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGTAASSHTEVAPTDPMPRRR
GRFKGLNGRYFQQQEPEPGLQGGMEASAQPPTSEAAVNQMEPPLAMAVTEMLGSGQSRSP
WADLTNEVDMPGAGSAGGKSSPEPWLWPPTMVPPSISGHSRAPVLELEKAEGPSARPATP
DLFWSPLEATVSAPSPAPWEAFPVATSPDLPMMAMLRGPKEWMLPHPTPISTEANRVEAH
GEATATAPPSPAAETKVYSLPLSLTPTGQGGEAMPTTPESPRADFRETGETSPAQVNKAE
HSSSSPWPSVNRNVAVGFVPTETATEPTGLRGIPGSESGVFDTAESPTSGLQATVDEVQD
PWPSVYSKGLDASSPSAPLGSPGVFLVPKVTPNLEPWVATDEGPTVNPMDSTVTPAPSDA
SGIWEPGSQVFEEAESTTLSPQVALDTSIVTPLTTLEQGDKVGVPAMSTLGSSSSQPHPE
PEDQVETQGTSGASVPPHQSSPLGKPAVPPGTPTAASVGESASVSSGEPTVPWDPSSTLL
PVTLGIEDFELEVLAGSPGVESFWEEVASGEEPALPGTPMNAGAEEVHSDPCENNPCLHG
GTCNANGTMYGCSCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPSYGGSF
CEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAEKDCRRRSGHLTSVHSPEEHSFINSFGH
ENTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPC
NYNLPYVCKKGTVLCGPPPAVENASLIGARKAKYNVHATVRYQCNEGFAQHHVATIRCRS
NGKWDRPQIVCTKPRRSHRMRRHHHHHQHHHQHHHHKSRKERRKHKKHPTEDWEKDEGNF
C
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atgggggccccgtttgtctgggccttgggccttttgatgctgcagatgctgctctttgtg
gctggggaacagggcacacaggatatcaccgatgccagcgaaagggggctccacatgcag
aagctggggtctgggtcagtgcaggctgcgctggcggagctggtggccctgccctgtctc
tttaccctgcagccacggccaagcgcagcccgagatgcccctcggataaagtggaccaag
gtgcggactgcgtcgggccagcgacaggacttgcccatcctggtggccaaggacaatgtc
gtgagggtggccaaaagctggcagggacgagtgtcactgccttcctacccccggcgccga
gccaacgccacgctacttctggggccactgagggccagtgactctgggctgtaccgctgc
caggtggtgaggggcatcgaggatgagcaggacctggtgcccttggaggtgacaggtgtt
gtgttccactaccgatcagcccgggaccgctatgcactgaccttcgctgaggcccaggag
gcctgccgtctcagctcagccatcattgcagcccctcggcatctacaggctgcctttgag
gatggctttgacaactgtgatgctggctggctctctgaccgcactgttcggtatcctatc
acccagtcccgtcctggttgctatggcgaccgtagcagccttccaggggttcggagctat
gggaggcgcaacccacaggaactctacgatgtgtattgctttgcccgggagctggggggc
gaggtcttctacgtgggcccggcccgccgcctgacactggccggcgcgcgtgcacagtgc
cgccgccagggtgccgcgctggcctcggtgggacagctgcacctggcctggcatgagggc
ctggaccagtgcgacccgggctggctggccgacggcagcgtgcgctacccgatccagacg
ccgcgccggcgctgcgggggcccagccccgggcgtgcgcaccgtctaccgcttcgctaac
cggaccggcttcccctcacccgccgagcgcttcgacgcctactgcttccgagctcatcac
cccacgtcacaacatggagacctagagaccccatcctctggggatgagggggagattctg
tcagcagaggggcccccagttagagaactggagcccaccctggaggaggaagaggtggtc
acccctgacttccaggagcctctggtgtccagtggggaagaagaaaccctgattttggag
gagaagcaggagtctcaacagaccctcagccctacccctggggaccccatgctggcctca
tggcccactggggaagtgtggctaagcacggtggcccccagccctagcgacatgggggca
ggcactgcagcaagttcacacacggaggtggccccaactgaccctatgcctaggagaagg
gggcgcttcaaagggttgaatgggcgctacttccagcagcaggaaccggagccggggctg
caaggggggatggaggccagcgcccagccccccacctcagaggctgcagtgaaccaaatg
gagcctccgttggccatggcagtcacagagatgttgggcagtggccagagccggagcccc
tgggctgatctgaccaatgaggtggatatgcctggagctggttctgctggtggcaagagc
tccccagagccctggctgtggccccctaccatggtcccacccagcatctcaggccacagc
agggcccctgtcctggagctagagaaagccgagggccccagtgccaggccagccacccca
gacctgttttggtcccccttggaggccactgtctcagctcccagccctgccccctgggag
gcattccctgtggccacctccccagatctccctatgatggccatgctgcgtggtcccaaa
gagtggatgctaccacaccccacccccatctccaccgaggccaatagagttgaggcacat
ggtgaggccaccgccacggctccaccctcccctgctgcagagaccaaggtgtattccctg
cctctctctttgaccccaacaggacagggtggagaggccatgcccacaacacctgagtcc
cccagggcagacttcagagaaactggggagaccagccctgctcaggtcaacaaagctgag
cactccagctccagcccatggccttctgtaaacaggaatgtggctgtaggttttgtcccc
actgagactgccactgagccaacgggcctcaggggtatcccggggtctgagtctggggtc
ttcgacacagcagaaagccccacttctggcttgcaggccactgtagatgaggtgcaggac
ccctggccctcagtgtacagcaaagggctggatgcaagttccccatctgcccccctgggg
agccctggagtcttcttggtacccaaagtcaccccaaatttggagccttgggttgctaca
gatgaaggacccactgtgaatcccatggattccacagtcacgccggcccccagtgatgct
agtggaatttgggaacctggatcccaggtgtttgaagaagccgaaagcaccaccttgagc
cctcaggtggccctggatacaagcattgtgacgcccctcacgaccctggagcagggggac
aaggttggagttccagccatgtctacactgggctcctcaagctcccaaccccacccagag
ccagaggatcaggtggagacccagggaacatcaggagcttcagtgcctccgcatcagagc
agtcccctagggaaaccggctgttcctcctgggacaccgactgcagccagtgtgggcgag
tctgcctcagtttcctcaggggagcctacggtaccgtgggacccctccagcaccctgctg
cctgtcaccctgggcatagaggacttcgaactggaggtcctggcagggagcccgggtgta
gagagcttctgggaggaggtggcaagtggagaggagccagccctgccagggacccctatg
aatgcaggtgcggaggaggtgcactcagatccctgtgagaacaacccttgtcttcatgga
gggacatgtaatgccaatggcaccatgtatggctgtagctgtgatcagggcttcgccggg
gagaactgtgagattgacattgatgactgcctctgcagcccctgtgagaatggaggcacc
tgtattgatgaggtcaatggctttgtctgcctttgcctccccagctatgggggcagcttt
tgtgagaaagacaccgagggctgtgaccgcggctggcataagttccagggccactgttac
cgctattttgcccaccggagggcatgggaagatgccgagaaggactgccgccgccgctcc
ggccacctgaccagcgtccactcaccggaggaacacagcttcattaatagctttgggcat
gaaaacacgtggatcggcctgaacgacaggatcgtggagagagatttccagtggacggac
aacaccgggctgcaatttgagaactggcgagagaaccagccggacaatttcttcgcgggt
ggcgaggactgtgtggtgatggtggcgcatgaaagcgggcgctggaacgatgtcccctgc
aactacaacctaccctatgtctgcaagaagggcacagtgctctgtggtccccctccggca
gtggagaatgcctcactcatcggtgcccgcaaggccaagtacaatgtccatgccactgta
aggtaccagtgcaatgaaggatttgcccagcaccatgtggccaccattcgatgccggagc
aatggcaagtgggacaggccccaaattgtctgcaccaaacccagacgttcacatcggatg
cggcgacaccaccaccaccaccaacaccaccaccagcatcaccaccacaaatcccgcaag
gagcgcagaaaacacaagaaacacccaacggaggactgggagaaggacgaagggaatttc
tgctga

DBGET integrated database retrieval system