KEGG   Homo sapiens (human): 1464Help
Entry
1464              CDS       T01001                                 

Gene name
CSPG4, HMW-MAA, MCSP, MCSPG, MEL-CSPG, MSK16, NG2
Definition
(RefSeq) chondroitin sulfate proteoglycan 4
  KO
K08115  chondroitin sulfate proteoglycan 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    1464 (CSPG4)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Others
   1464 (CSPG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin_3 Laminin_G_2 Laminin_G_1 Cadherin_4 Big_9 DUF3377
Motif
Other DBs
NCBI-GeneID: 1464
NCBI-ProteinID: NP_001888
OMIM: 601172
HGNC: 2466
Ensembl: ENSG00000173546
Vega: OTTHUMG00000142836
Pharos: Q6UVK1(Tbio)
UniProt: Q6UVK1
Position
15q24.2
AA seq 2322 aa AA seqDB search
MQSGPRPPLPAPGLALALTLTMLARLASAASFFGENHLEVPVATALTDIDLQLQFSTSQP
EALLLLAAGPADHLLLQLYSGRLQVRLVLGQEELRLQTPAETLLSDSIPHTVVLTVVEGW
ATLSVDGFLNASSAVPGAPLEVPYGLFVGGTGTLGLPYLRGTSRPLRGCLHAATLNGRSL
LRPLTPDVHEGCAEEFSASDDVALGFSGPHSLAAFPAWGTQDEGTLEFTLTTQSRQAPLA
FQAGGRRGDFIYVDIFEGHLRAVVEKGQGTVLLHNSVPVADGQPHEVSVHINAHRLEISV
DQYPTHTSNRGVLSYLEPRGSLLLGGLDAEASRHLQEHRLGLTPEATNASLLGCMEDLSV
NGQRRGLREALLTRNMAAGCRLEEEEYEDDAYGHYEAFSTLAPEAWPAMELPEPCVPEPG
LPPVFANFTQLLTISPLVVAEGGTAWLEWRHVQPTLDLMEAELRKSQVLFSVTRGARHGE
LELDIPGAQARKMFTLLDVVNRKARFIHDGSEDTSDQLVLEVSVTARVPMPSCLRRGQTY
LLPIQVNPVNDPPHIIFPHGSLMVILEHTQKPLGPEVFQAYDPDSACEGLTFQVLGTSSG
LPVERRDQPGEPATEFSCRELEAGSLVYVHRGGPAQDLTFRVSDGLQASPPATLKVVAIR
PAIQIHRSTGLRLAQGSAMPILPANLSVETNAVGQDVSVLFRVTGALQFGELQKQGAGGV
EGAEWWATQAFHQRDVEQGRVRYLSTDPQHHAYDTVENLALEVQVGQEILSNLSFPVTIQ
RATVWMLRLEPLHTQNTQQETLTTAHLEATLEEAGPSPPTFHYEVVQAPRKGNLQLQGTR
LSDGQGFTQDDIQAGRVTYGATARASEAVEDTFRFRVTAPPYFSPLYTFPIHIGGDPDAP
VLTNVLLVVPEGGEGVLSADHLFVKSLNSASYLYEVMERPRHGRLAWRGTQDKTTMVTSF
TNEDLLRGRLVYQHDDSETTEDDIPFVATRQGESSGDMAWEEVRGVFRVAIQPVNDHAPV
QTISRIFHVARGGRRLLTTDDVAFSDADSGFADAQLVLTRKDLLFGSIVAVDEPTRPIYR
FTQEDLRKRRVLFVHSGADRGWIQLQVSDGQHQATALLEVQASEPYLRVANGSSLVVPQG
GQGTIDTAVLHLDTNLDIRSGDEVHYHVTAGPRWGQLVRAGQPATAFSQQDLLDGAVLYS
HNGSLSPRDTMAFSVEAGPVHTDATLQVTIALEGPLAPLKLVRHKKIYVFQGEAAEIRRD
QLEAAQEAVPPADIVFSVKSPPSAGYLVMVSRGALADEPPSLDPVQSFSQEAVDTGRVLY
LHSRPEAWSDAFSLDVASGLGAPLEGVLVELEVLPAAIPLEAQNFSVPEGGSLTLAPPLL
RVSGPYFPTLLGLSLQVLEPPQHGALQKEDGPQARTLSAFSWRMVEEQLIRYVHDGSETL
TDSFVLMANASEMDRQSHPVAFTVTVLPVNDQPPILTTNTGLQMWEGATAPIPAEALRST
DGDSGSEDLVYTIEQPSNGRVVLRGAPGTEVRSFTQAQLDGGLVLFSHRGTLDGGFRFRL
SDGEHTSPGHFFRVTAQKQVLLSLKGSQTLTVCPGSVQPLSSQTLRASSSAGTDPQLLLY
RVVRGPQLGRLFHAQQDSTGEALVNFTQAEVYAGNILYEHEMPPEPFWEAHDTLELQLSS
PPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSP
QRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHF
RAHLQGPAGASVAGPQTSEAFAITVRDVNERPPQPQASVPLRLTRGSRAPISRAQLSVVD
PDSAPGEIEYEVQRAPHNGFLSLVGGGLGPVTRFTQADVDSGRLAFVANGSSVAGIFQLS
MSDGASPPLPMSLAVDILPSAIEVQLRAPLEVPQALGRSSLSQQQLRVVSDREEPEAAYR
LIQGPQYGHLLVGGRPTSAFSQFQIDQGEVVFAFTNFSSSHDHFRVLALARGVNASAVVN
VTVRALLHVWAGGPWPQGATLRLDPTVLDAGELANRTGSVPRFRLLEGPRHGRVVRVPRA
RTEPGGSQLVEQFTQQDLEDGRLGLEVGRPEGRAPGPAGDSLTLELWAQGVPPAVASLDF
ATEPYNAARPYSVALLSVPEAARTEAGKPESSTPTGEPGPMASSPEPAVAKGGFLSFLEA
NMFSVIIPMCLVLLLLALILPLLFYLRKRNKTGKHDVQVLTAKPRNGLAGDTETFRKVEP
GQAIPLTAVPGQGPPPGGQPDPELLQFCRTPNPALKNGQYWV
NT seq 6969 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccgggccgcggcccccacttccagcccccggcctggccttggctttgaccctg
actatgttggccagacttgcatccgcggcttccttcttcggtgagaaccacctggaggtg
cctgtggccacggctctgaccgacatagacctgcagctgcagttctccacgtcccagccc
gaagccctccttctcctggcagcaggcccagctgaccacctcctgctgcagctctactct
ggacgcctgcaggtcagacttgttctgggccaggaggagctgaggctgcagactccagca
gagacgctgctgagtgactccatcccccacactgtggtgctgactgtcgtagagggctgg
gccacgttgtcagtcgatgggtttctgaacgcctcctcagcagtcccaggagccccccta
gaggtcccctatgggctctttgttgggggcactgggacccttggcctgccctacctgagg
ggaaccagccgacccctgaggggttgcctccatgcagccaccctcaatggccgcagcctc
ctccggcctctgacccccgatgtgcatgagggctgtgctgaagagttttctgccagtgat
gatgtggccctgggcttctctgggccccactctctggctgccttccctgcctggggcact
caggacgaaggaaccctagagtttacactcaccacacagagccggcaggcacccttggcc
ttccaggcagggggccggcgtggggacttcatctatgtggacatatttgagggccacctg
cgggccgtggtggagaagggccagggtaccgtattgctccacaacagtgtgcctgtggcc
gatgggcagccccatgaggtcagtgtccacatcaatgctcaccggctggaaatctccgtg
gaccagtaccctacgcatacttcgaaccgaggagtcctcagctacctggagccacggggc
agtctccttctcggggggctggatgcagaggcctctcgtcacctccaggaacaccgcctg
ggcctgacaccagaggccaccaatgcctccctgctgggctgcatggaagacctcagtgtc
aatggccagaggcgggggctgcgggaagctttgctgacgcgcaacatggcagccggctgc
aggctggaggaggaggagtatgaggacgatgcctatggacattatgaagctttctccacc
ctggcccctgaggcttggccagccatggagctgcctgagccatgcgtgcctgagccaggg
ctgcctcctgtctttgccaatttcacccagctgctgactatcagcccactggtggtggcc
gaggggggcacagcctggcttgagtggaggcatgtgcagcccacgctggacctgatggag
gctgagctgcgcaaatcccaggtgctgttcagcgtgacccgaggggcacgccatggcgag
ctcgagctggacatcccgggagcccaggcacgaaaaatgttcaccctcctggacgtggtg
aaccgcaaggcccgcttcatccacgatggctctgaggacacctccgaccagctggtgctg
gaggtgtcggtgacggctcgggtgcccatgccctcatgccttcggaggggccaaacatac
ctcctgcccatccaggtcaaccctgtcaatgacccaccccacatcatcttcccacatggc
agcctcatggtgatcctggaacacacgcagaagccgctggggcctgaggttttccaggcc
tatgacccggactctgcctgtgagggcctcaccttccaggtccttggcacctcctctggc
ctccccgtggagcgccgagaccagcctggggagccggcgaccgagttctcctgccgggag
ttggaggccggcagcctagtctatgtccaccgcggtggtcctgcacaggacttgacgttc
cgggtcagcgatggactgcaggccagccccccggccacgctgaaggtggtggccatccgg
ccggccatacagatccaccgcagcacagggttgcgactggcccaaggctctgccatgccc
atcttgcccgccaacctgtcggtggagaccaatgccgtggggcaggatgtgagcgtgctg
ttccgcgtcactggggccctgcagtttggggagctgcagaagcagggggcaggtggggtg
gagggtgctgagtggtgggccacacaggcgttccaccagcgggatgtggagcagggccgc
gtgaggtacctgagcactgacccacagcaccacgcttacgacaccgtggagaacctggcc
ctggaggtgcaggtgggccaggagatcctgagcaatctgtccttcccagtgaccatccag
agagccactgtgtggatgctgcggctggagccactgcacactcagaacacccagcaggag
accctcaccacagcccacctggaggccaccctggaggaggcaggcccaagccccccaacc
ttccattatgaggtggttcaggctcccaggaaaggcaaccttcaactacagggcacaagg
ctgtcagatggccagggcttcacccaggatgacatacaggctggccgggtgacctatggg
gccacagcacgtgcctcagaggcagtcgaggacaccttccgtttccgtgtcacagctcca
ccatatttctccccactctataccttccccatccacattggtggtgacccagatgcgcct
gtcctcaccaatgtcctcctcgtggtgcctgagggtggtgagggtgtcctctctgctgac
cacctctttgtcaagagtctcaacagtgccagctacctctatgaggtcatggagcggccc
cgccatgggaggttggcttggcgtgggacacaggacaagaccactatggtgacatccttc
accaatgaagacctgttgcgtggccggctggtctaccagcatgatgactccgagaccaca
gaagatgatatcccatttgttgctacccgccagggcgagagcagtggtgacatggcctgg
gaggaggtacggggtgtcttccgagtggccatccagcccgtgaatgaccacgcccctgtg
cagaccatcagccggatcttccatgtggcccggggtgggcggcggctgctgactacagac
gacgtggccttcagcgatgctgactcgggctttgctgacgcccagctggtgcttacccgc
aaggacctcctctttggcagtatcgtggccgtagatgagcccacgcggcccatctaccgc
ttcacccaggaggacctcaggaagaggcgagtactgttcgtgcactcaggggctgaccgt
ggctggatccagctgcaggtgtccgacgggcaacaccaggccactgcgctgctggaggtg
caggcctcggaaccctacctccgtgtggccaacggctccagccttgtggtccctcaagga
ggccagggcaccatcgacacggccgtgctccacctggacaccaacctcgacatccgcagt
ggggatgaggtccactaccacgtcacagctggccctcgctggggacagctagtccgggct
ggtcagccagccacagccttctcccagcaggacctgctggatggggccgttctctatagc
cacaatggcagcctcagcccccgcgacaccatggccttctccgtggaagcagggccagtg
cacacggatgccaccctacaagtgaccattgccctagagggcccactggccccactgaag
ctggtccggcacaagaagatctacgtcttccagggagaggcagctgagatcagaagggac
cagctggaggcagcccaggaggcagtgccacctgcagacatcgtattctcagtgaagagc
ccaccgagtgccggctacctggtgatggtgtcgcgtggcgccttggcagatgagccaccc
agcctggaccctgtgcagagcttctcccaggaggcagtggacacaggcagggtcctgtac
ctgcactcccgccctgaggcctggagcgatgccttctcgctggatgtggcctcaggcctg
ggtgctcccctcgagggcgtccttgtggagctggaggtgctgcccgctgccatcccacta
gaggcgcaaaacttcagcgtccctgagggtggcagcctcaccctggcccctccactgctc
cgtgtctccgggccctacttccccactctcctgggcctcagcctgcaggtgctggagcca
ccccagcatggagccctgcagaaggaggacggacctcaagccaggaccctcagcgccttc
tcctggagaatggtggaagagcagctgatccgctacgtgcatgacgggagcgagacactg
acagacagttttgtcctgatggctaatgcctccgagatggatcgccagagccatcctgtg
gccttcactgtcactgtcctgcctgtcaatgaccaaccccccatcctcactacaaacaca
ggcctgcagatgtgggagggggccactgcgcccatccctgcggaggctctgaggagcacg
gacggcgactctgggtctgaggatctggtctacaccatcgagcagcccagcaacgggcgg
gtagtgctgcggggggcgccgggcactgaggtgcgcagcttcacgcaggcccagctggac
ggcgggctcgtgctgttctcacacagaggaaccctggatggaggcttccgcttccgcctc
tctgacggcgagcacacttcccccggacacttcttccgagtgacggcccagaagcaagtg
ctcctctcgctgaagggcagccagacactgactgtctgcccagggtccgtccagccactc
agcagtcagaccctcagggccagctccagcgcaggcactgacccccagctcctgctctac
cgtgtggtgcggggcccccagctaggccggctgttccacgcccagcaggacagcacaggg
gaggccctggtgaacttcactcaggcagaggtctacgctgggaatattctgtatgagcat
gagatgccccccgagcccttttgggaggcccatgataccctagagctccagctgtcctcg
ccgcctgcccgggacgtggccgccacccttgctgtggctgtgtcttttgaggctgcctgt
ccccagcgccccagccacctctggaagaacaaaggtctctgggtccccgagggccagcgg
gccaggatcaccgtggctgctctggatgcctccaatctcttggccagcgttccatcaccc
cagcgctcagagcatgatgtgctcttccaggtcacacagttccccagccggggccagctg
ttggtgtccgaggagcccctccatgctgggcagccccacttcctgcagtcccagctggct
gcagggcagctagtgtatgcccacggcggtgggggcacccagcaggatggcttccacttt
cgtgcccacctccaggggccagcaggggcctccgtggctggaccccaaacctcagaggcc
tttgccatcacggtgagggatgtaaatgagcggccccctcagccacaggcctctgtccca
ctccggctcacccgaggctctcgtgcccccatctcccgggcccagctgagtgtggtggac
ccagactcagctcctggggagattgagtacgaggtccagcgggcaccccacaacggcttc
ctcagcctggtgggtggtggcctggggcccgtgacccgcttcacgcaagccgatgtggat
tcagggcggctggccttcgtggccaacgggagcagcgtggcaggcatcttccagctgagc
atgtctgatggggccagcccacccctgcccatgtccctggctgtggacatcctaccatcc
gccatcgaggtgcagctgcgggcacccctggaggtgccccaagctttggggcgctcctca
ctgagccagcagcagctccgggtggtttcagatcgggaggagccagaggcagcataccgc
ctcatccagggaccccagtatgggcatctcctggtgggcgggcggcccacctcggccttc
agccaattccagatagaccagggcgaggtggtctttgccttcaccaacttctcctcctct
catgaccacttcagagtcctggcactggctaggggtgtcaatgcatcagccgtagtgaac
gtcactgtgagggctctgctgcatgtgtgggcaggtgggccatggccccagggtgccacc
ctgcgcctggaccccaccgtcctagatgctggcgagctggccaaccgcacaggcagtgtg
ccgcgcttccgcctcctggagggaccccggcatggccgcgtggtccgcgtgccccgagcc
aggacggagcccgggggcagccagctggtggagcagttcactcagcaggaccttgaggac
gggaggctggggctggaggtgggcaggccagaggggagggcccccggccccgcaggtgac
agtctcactctggagctgtgggcacagggcgtcccgcctgctgtggcctccctggacttt
gccactgagccttacaatgctgcccggccctacagcgtggccctgctcagtgtccccgag
gccgcccggacggaagcagggaagccagagagcagcacccccacaggcgagccaggcccc
atggcatccagccctgagcccgctgtggccaagggaggcttcctgagcttccttgaggcc
aacatgttcagcgtcatcatccccatgtgcctggtacttctgctcctggcgctcatcctg
cccctgctcttctacctccgaaaacgcaacaagacgggcaagcatgacgtccaggtcctg
actgccaagccccgcaacggcctggctggtgacaccgagacctttcgcaaggtggagcca
ggccaggccatcccgctcacagctgtgcctggccaggggccccctccaggaggccagcct
gacccagagctgctgcagttctgccggacacccaaccctgcccttaagaatggccagtac
tgggtgtga

DBGET integrated database retrieval system