KEGG   Homo sapiens (human): 1465Help
Entry
1465              CDS       T01001                                 

Gene name
CSRP1, CRP, CRP1, CSRP, CYRP, D1S181E, HEL-141, HEL-S-286
Definition
(RefSeq) cysteine and glycine rich protein 1
  KO
K09377  cysteine and glycine-rich protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1465 (CSRP1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain with LIM region, LIM-only transcription (co-)factors
    1465 (CSRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM TNFR_c6 zf-ACC
Motif
Other DBs
NCBI-GeneID: 1465
NCBI-ProteinID: NP_001180500
OMIM: 123876
HGNC: 2469
Ensembl: ENSG00000159176
Vega: OTTHUMG00000035773
Pharos: P21291(Tbio)
UniProt: P21291 A0A384P5K2
Position
1q32.1
AA seq 193 aa AA seqDB search
MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKS
CYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP
RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGF
GFGQGAGALVHSE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccgaactggggaggaggcaagaaatgtggggtgtgtcagaagacggtttactttgcc
gaagaggttcagtgcgaaggcaacagcttccataaatcctgcttcctgtgcatggtctgc
aagaagaatctggacagtaccactgtggccgtgcatggtgaggagatttactgcaagtcc
tgctacggcaagaagtatgggcccaaaggctatggctacgggcagggcgcaggcaccctc
agcactgacaagggggagtcgctgggtatcaagcacgaggaagcccctggccacaggccc
accaccaaccccaatgcatccaaatttgcccagaagattggtggctccgagcgctgcccc
cgatgcagccaggcagtctatgctgcggagaaggtgattggtgctgggaagtcctggcat
aaggcctgctttcgatgtgccaagtgtggcaaaggccttgagtcaaccaccctggcagac
aaggatggcgagatttactgcaaaggatgttatgctaaaaacttcgggcccaagggcttt
ggttttgggcaaggagctggggccttggtccactctgagtga

DBGET integrated database retrieval system