KEGG   Homo sapiens (human): 146556Help
Entry
146556            CDS       T01001                                 

Gene name
C16orf89
Definition
(RefSeq) chromosome 16 open reading frame 89
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4735
Motif
Other DBs
NCBI-GeneID: 146556
NCBI-ProteinID: NP_689672
HGNC: 28687
Ensembl: ENSG00000153446
Vega: OTTHUMG00000159314
Pharos: Q6UX73(Tbio)
UniProt: Q6UX73
Position
16p13.3
AA seq 402 aa AA seqDB search
MASLGLLLLLLLTALPPLWSSSLPGLDTAESKATIADLILSALERATVFLEQRLPEINLD
GMVGVRVLEEQLKSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLRE
FQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLS
DLCRSLMTKPGCSGYCLSHQLLFFLWARMRGCTQGPLQQSQDYINLFCANMMDLNRRAEA
IGYAYPTRDIFMENIMFCGMGGFSDFYKLRWLEAILSWQKQQEGCFGEPDAEDEELSKAI
QYQQHFSRRVKRREKQFPDSRSVAQAGVQWRNLGSLQPLPPGFKQFSCLILPSSWDYRSV
PPYLANFYIFLVETGFHHVAHAGLELLISRDPPTSGSQSVGL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccagcctggggctgctgctcctgctcttactgacagcactgccaccgctgtggtcc
tcctcactgcctgggctggacactgctgaaagtaaagccaccattgcagacctgatcctg
tctgcgctggagagagccaccgtcttcctagaacagaggctgcctgaaatcaacctggat
ggcatggtgggggtccgagtgctggaagagcagctaaaaagtgtccgggagaagtgggcc
caggagcccctgctgcagccgctgagcctgcgcgtggggatgctgggggagaagctggag
gctgccatccagagatccctccactacctcaagctgagtgatcccaagtacctaagagag
ttccagctgaccctccagcccgggttttggaagctcccacatgcctggatccacactgat
gcctccttggtgtaccccacgttcgggccccaggactcattctcagaggagagaagtgac
gtgtgcctggtgcagctgctgggaaccgggacggacagcagcgagccctgcggcctctca
gacctctgcaggagcctcatgaccaagcccggctgctcaggctactgcctgtcccaccaa
ctgctcttcttcctctgggccagaatgagggggtgcacacagggaccactccaacagagc
caggactatatcaacctcttctgcgccaacatgatggacttgaaccgcagagctgaggcc
atcggatacgcctaccctacccgggacatcttcatggaaaacatcatgttctgtggaatg
ggcggcttctccgacttctacaagctccggtggctggaggccattctcagctggcagaaa
cagcaggaaggatgcttcggggagcctgatgctgaagatgaagaattatctaaagctatt
caatatcagcagcatttttcgaggagagtgaagaggcgagaaaaacaatttccagattct
cgctctgttgctcaggctggagtacagtggcgcaatctcggctcactgcaacctttgcct
cctgggttcaagcaattctcttgcctcatcctcccgagtagctgggactacaggagcgtg
ccaccatacctggctaatttttatatttttttagtagagacagggtttcatcatgttgct
catgctggtctcgaactcctgatctcaagagatccgcccacctcaggctcccaaagtgtg
ggattatag

DBGET integrated database retrieval system