KEGG   Homo sapiens (human): 146556
Entry
146556            CDS       T01001                                 
Symbol
C16orf89
Name
(RefSeq) chromosome 16 open reading frame 89
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4735
Other DBs
NCBI-GeneID: 146556
NCBI-ProteinID: NP_689672
HGNC: 28687
Ensembl: ENSG00000153446
Pharos: Q6UX73(Tbio)
UniProt: Q6UX73
Position
16:complement(5042772..5065956)
AA seq 402 aa
MASLGLLLLLLLTALPPLWSSSLPGLDTAESKATIADLILSALERATVFLEQRLPEINLD
GMVGVRVLEEQLKSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLRE
FQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLS
DLCRSLMTKPGCSGYCLSHQLLFFLWARMRGCTQGPLQQSQDYINLFCANMMDLNRRAEA
IGYAYPTRDIFMENIMFCGMGGFSDFYKLRWLEAILSWQKQQEGCFGEPDAEDEELSKAI
QYQQHFSRRVKRREKQFPDSRSVAQAGVQWRNLGSLQPLPPGFKQFSCLILPSSWDYRSV
PPYLANFYIFLVETGFHHVAHAGLELLISRDPPTSGSQSVGL
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggccagcctggggctgctgctcctgctcttactgacagcactgccaccgctgtggtcc
tcctcactgcctgggctggacactgctgaaagtaaagccaccattgcagacctgatcctg
tctgcgctggagagagccaccgtcttcctagaacagaggctgcctgaaatcaacctggat
ggcatggtgggggtccgagtgctggaagagcagctaaaaagtgtccgggagaagtgggcc
caggagcccctgctgcagccgctgagcctgcgcgtggggatgctgggggagaagctggag
gctgccatccagagatccctccactacctcaagctgagtgatcccaagtacctaagagag
ttccagctgaccctccagcccgggttttggaagctcccacatgcctggatccacactgat
gcctccttggtgtaccccacgttcgggccccaggactcattctcagaggagagaagtgac
gtgtgcctggtgcagctgctgggaaccgggacggacagcagcgagccctgcggcctctca
gacctctgcaggagcctcatgaccaagcccggctgctcaggctactgcctgtcccaccaa
ctgctcttcttcctctgggccagaatgagggggtgcacacagggaccactccaacagagc
caggactatatcaacctcttctgcgccaacatgatggacttgaaccgcagagctgaggcc
atcggatacgcctaccctacccgggacatcttcatggaaaacatcatgttctgtggaatg
ggcggcttctccgacttctacaagctccggtggctggaggccattctcagctggcagaaa
cagcaggaaggatgcttcggggagcctgatgctgaagatgaagaattatctaaagctatt
caatatcagcagcatttttcgaggagagtgaagaggcgagaaaaacaatttccagattct
cgctctgttgctcaggctggagtacagtggcgcaatctcggctcactgcaacctttgcct
cctgggttcaagcaattctcttgcctcatcctcccgagtagctgggactacaggagcgtg
ccaccatacctggctaatttttatatttttttagtagagacagggtttcatcatgttgct
catgctggtctcgaactcctgatctcaagagatccgcccacctcaggctcccaaagtgtg
ggattatag

DBGET integrated database retrieval system