KEGG   Homo sapiens (human): 146722
Entry
146722            CDS       T01001                                 
Symbol
CD300LF, CD300f, CLM-1, CLM1, IREM-1, IREM1, IgSF13, LMIR3, NKIR
Name
(RefSeq) CD300 molecule like family member f
  KO
K20395  CO300B/D/F antigen
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    146722 (CD300LF)
SSDB
Motif
Pfam: SIT V-set ig TMEM154 Psg1
Other DBs
NCBI-GeneID: 146722
NCBI-ProteinID: NP_620587
OMIM: 609807
HGNC: 29883
Ensembl: ENSG00000186074
Pharos: Q8TDQ1(Tbio)
UniProt: Q8TDQ1
Structure
Position
17:complement(74694317..74712923)
AA seq 290 aa
MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWR
DCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVT
VQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRM
MKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMA
SLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEEPTEYSTISRP
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcccctgctgacactctacctgctcctcttctggctctcaggctactccattgtcact
caaatcaccggtccaacaacagtgaatggcttggagcggggctccttgaccgtgcagtgt
gtttacagatcaggctgggagacctacttgaagtggtggtgtcgaggagctatttggcgt
gactgcaagatccttgttaaaaccagtgggtcagagcaggaggtgaagagggaccgggtg
tccatcaaggacaatcagaaaaaccgcacgttcactgtgaccatggaggatctcatgaaa
actgatgctgacacttactggtgtggaattgagaaaactggaaatgaccttggggtcaca
gttcaagtgaccattgacccagcaccagtcacccaagaagaaactagcagctccccaact
ctgaccggccaccacttggacaacaggcacaagctcctgaagctcagtgtcctcctgccc
ctcatcttcaccatattgctgctgcttttggtggccgcctcactcttggcttggaggatg
atgaagtaccagcagaaagcagccgggatgtccccagagcaggtactgcagcccctggag
ggcgacctctgctatgcagacctgaccctgcagctggccggaacctccccgcaaaaggct
accacgaagctttcctctgcccaggttgaccaggtggaagtggaatatgtcaccatggct
tccttgccgaaggaggacatttcctatgcatctctgaccttgggtgctgaggatcaggaa
ccgacctactgcaacatgggccacctcagtagccacctccccggcaggggccctgaggag
cccacggaatacagcaccatcagcaggccttag

DBGET integrated database retrieval system