KEGG   Homo sapiens (human): 146861
Entry
146861            CDS       T01001                                 

Symbol
SLC35G3, AMAC1, TMEM21A
Name
(RefSeq) solute carrier family 35 member G3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-GeneID: 146861
NCBI-ProteinID: NP_689675
HGNC: 26848
Ensembl: ENSG00000164729
Vega: OTTHUMG00000132929
Pharos: Q8N808(Tdark)
UniProt: Q8N808
Position
17q12
AA seq 338 aa
MAGSHPYFNQPDSTHPSPPSAPPSLRWYQRCQPSDATSGLLVALLGGGLPAGFVGPLSRM
AYQASNLPSLELLIWRCLFHLPIALLLKLRGDPLLGTPDIRSRAFFCALLNILSIGCAYS
AVQVVPAGNAATVRKGSSTVCSAVLTLCLESQGLSGYDWCGLLGCILGLIIIVGPGLWTL
QEGTTGVYTALGYVEAFLGGLALSLRLLVYRSLHFPPCLPTVAFLSGLVGLLGSVPGLFV
LQAPVLPSDLLSWSCVGAVGILALVSFTCVGYAVTKAHPALVCAVLHSEVVVALILQYYM
LHETVAPSDIVAAGVVLGSIAIITAQNLSCERTGRVEE
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggctggcagtcacccctatttcaaccagcctgactccacacacccatcgccgccctcc
gctccacccagcctccgctggtaccagcgctgccagccctctgatgccaccagtggcctg
ctggtggccctgctgggtgggggcctgcctgctggcttcgtgggccccctttctcgtatg
gcttaccaggcttccaacctgccctcgctggagctgctcatctggcgatgcctcttccac
ctccctattgccctgctacttaaactgcgtggcgacccccttctgggaactcctgacatc
cgaagccgggccttcttctgtgccctgctcaacatcctcagcattggatgtgcctacagt
gcggttcaggtggtgcccgctggcaacgctgccactgttcgcaaaggttcttccaccgtc
tgctccgccgtcctcactctctgccttgagagccagggtctcagtggctacgactggtgt
ggactgttgggctgcatcctaggactaatcatcattgtgggacctggactctggacacta
caggaggggaccacgggtgtctacaccgccctgggctatgtggaggctttcctgggaggc
ctggcgctgtccctgaggcttctggtctatcgttctctgcactttcccccctgcctccca
acagtggccttcctatctggcttggtggggctgctgggctctgtgccaggcctctttgtg
ctgcaggcccccgtgttgcccagtgacctcctgagttggagttgtgtgggggcagtgggg
atcctcgccttggtctccttcacatgtgtgggctatgcggtcaccaaggcccaccctgcc
ctggtgtgcgctgtcctacattccgaggtggttgtggcccttatactgcagtattatatg
ctccatgagactgtggcaccttctgacatcgtggcggcaggggttgtgctgggcagcatt
gccatcattacagcccagaacctcagctgtgagaggacagggagggtggaggagtga

DBGET integrated database retrieval system