KEGG   Homo sapiens (human): 146894Help
Entry
146894            CDS       T01001                                 

Gene name
CD300LG, CLM-9, CLM9, NEPMUCIN, TREM-4, TREM4
Definition
(RefSeq) CD300 molecule like family member g
  KO
K16663  CMRF35-like molecule 9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    146894 (CD300LG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3 I-set
Motif
Other DBs
NCBI-GeneID: 146894
NCBI-ProteinID: NP_660316
OMIM: 610520
HGNC: 30455
Ensembl: ENSG00000161649
Vega: OTTHUMG00000181796
Pharos: Q6UXG3(Tdark)
UniProt: Q6UXG3
Position
17q21.31
AA seq 332 aa AA seqDB search
MRLLVLLWGCLLLPGYEALEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSR
CSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLI
SLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAE
APPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLDSTSAEDTSPALSSGSSKPR
VSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQATETQRNEKFCLSRLTAEEK
EAPSQAPEGDVISMPPLHTSEEELGFSKFVSA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttctggtcctgctatggggttgcctgctgctcccaggttatgaagccctggag
ggcccagaggaaatcagcgggttcgaaggggacactgtgtccctgcagtgcacctacagg
gaagagctgagggaccaccggaagtactggtgcaggaagggtgggatcctcttctctcgc
tgctctggcaccatctatgcagaagaagaaggccaggagacaatgaagggcagggtgtcc
atccgtgacagccgccaggagctctcgctcattgtgaccctgtggaacctcaccctgcaa
gacgctggggagtactggtgtggggtcgaaaaacggggccccgatgagtctttactgatc
tctctgttcgtctttccaggaccctgctgtcctccctccccttctcccaccttccagcct
ctggctacaacacgcctgcagcccaaggcaaaagctcagcaaacccagcccccaggattg
acttctcctgggctctacccggcagccaccacagccaagcaggggaagacaggggctgag
gcccctccattgccagggacttcccagtacgggcacgaaaggacttctcagtacacagga
acctctcctcacccagcgacctctcctcctgcagggagctcccgcccccccatgcagctg
gactccacctcagcagaggacaccagtccagctctcagcagtggcagctctaagcccagg
gtgtccatcccgatggtccgcatactggccccagtcctggtgctgctgagccttctgtca
gccgcaggcctgatcgccttctgcagccacctgctcctgtggagaaaggaagctcaacag
gccacggagacacagaggaacgagaagttctgcctctcacgcttgactgcggaggaaaag
gaagccccttcccaggcccctgagggggacgtgatctcgatgcctcccctccacacatct
gaggaggagctgggcttctcgaagtttgtctcagcgtag

DBGET integrated database retrieval system