KEGG   Homo sapiens (human): 146956Help
Entry
146956            CDS       T01001                                 

Gene name
EME1, MMS4L, SLX2A
Definition
(RefSeq) essential meiotic structure-specific endonuclease 1
  KO
K10882  crossover junction endonuclease EME1 [EC:3.1.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    146956 (EME1)
   03460 Fanconi anemia pathway
    146956 (EME1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    146956 (EME1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.-  
     146956 (EME1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     146956 (EME1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERCC4
Motif
Other DBs
NCBI-GeneID: 146956
NCBI-ProteinID: NP_689676
OMIM: 610885
HGNC: 24965
Ensembl: ENSG00000154920
Vega: OTTHUMG00000164974
Pharos: Q96AY2(Tbio)
UniProt: Q96AY2
Structure
PDB: 

Position
17q21.33
AA seq 570 aa AA seqDB search
MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDISDCEASCPPAP
ELFSPPVPEIAETVTQTQPVRLLSSESEDEEEFIPLAQRLTCKFLTHKQLSPEDSSSPVK
SVLDHQNNEGASCDWKKPFPKIPEVPLHDTPERSAADNKDLILDPCCQLPAYLSTCPGQS
SSLAVTKTNSDILPPQKKTKPSQKVQGRGSHGCRQQRQARQKESTLRRQERKNAALVTRM
KAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPS
EDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDITAKTAGKALS
LVIVDQEKCFSAQNPPRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAEEALVDLQLHTE
AQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLAL
VWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTS
TSRRIGPELSRRIYLQMTTLQPHLSLDSAD
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaagaagtcatcaccctcactggattctggtgatagtgactctgaggagttg
ccaacatttgcctttctgaagaaggaaccatcttcaacaaagaggagacagcctgaaagg
gaagagaagattgtagtggttgacatctcagattgtgaagcctcctgtcctccagcacca
gagttattttcaccacctgtcccagaaatagctgaaactgtcacacaaacacagccagtc
aggttgctaagcagtgaaagtgaagatgaagaagaatttattcctctggctcaaaggctt
acatgtaagtttctgacccacaagcaactgagccctgaggactctagctccccagttaaa
agtgttttggatcatcaaaataatgaaggtgcatcatgtgactggaaaaagccctttcca
aagatccctgaagttcccctccatgataccccagagaggagtgcagcagataacaaggac
ctgatcttagatccatgctgtcagcttccagcctacctgtctacctgccctggccagagc
agcagcttggcagtaaccaaaacaaattctgacatccttccaccccagaagaaaaccaag
ccgagtcagaaggtccagggaagaggctcacacggatgccggcagcagagacaagcaagg
cagaaggaaagcaccctgagaagacaggaaagaaagaatgcagcactggttaccaggatg
aaagcccagaggccagaggaatgcttaaaacacatcattgtagtgctggatccagtgctc
ttacagatggaaggtgggggccagctcctaggagcactgcagaccatggagtgccgctgt
gtgattgaggcgcaggctgtgccttgcagtgtcacttggaggagaagggctgggccgtct
gaggacagagaggactgggtggaggagccaacagtactggtgttgctccgggcagaggca
tttgtgtccatgatcgacaatggaaagcagggaagcctggacagcactatgaaagggaag
gaaacgcttcagggctttgtaactgacatcacagcaaagacagcagggaaagctctgtca
ctggtgattgtggatcaggagaaatgcttcagtgctcagaatcctccaagaagagggaaa
cagggagcaaataaacagaccaagaagcagcagcagagacaaccagaggccagcataggg
tccatggtatccagggtagacgctgaagaggcattggtggatctgcagctacacacagaa
gcccaggctcaaattgtgcagagctggaaagagctggccgacttcacatgcgcattcaca
aaggctgtggctgaggcgcccttcaagaagctccgagatgaaactaccttctccttctgt
ctggagagtgactgggctggaggggtgaaggtggaccttgctggcaggggactcgcacta
gtctggaggagacagattcagcagctgaaccgagtcagcctggaaatggccagtgcagtt
gtgaatgcctatccctccccacagctcctggtacaggcttatcagcagtgtttttcggat
aaagaacgccagaatttgctcgcagacatacaggtgcgccgtggggaaggtgtgacatcc
acttctcgccgcattggaccagaactatccaggcgtatctaccttcagatgaccacttta
cagccacatctctctttagatagtgctgactga

DBGET integrated database retrieval system