KEGG   Homo sapiens (human): 147Help
Entry
147               CDS       T01001                                 

Gene name
ADRA1B, ADRA1, ALPHA1BAR
Definition
(RefSeq) adrenoceptor alpha 1B
  KO
K04136  adrenergic receptor alpha-1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04970  Salivary secretion
Drug target
Adrenalone (DG00016): D02774 D07560
Amidephrine mesylate: D02901
Amiodarone (DG00204): D00636 D02910
Amosulalol (DG01302): D01469 D07451
Arotinolol (DG01303): D01830 D07465
Bevantolol: D01369
Bunazosin (DG01316): D01887 D07550
Bunitrolol hydrochloride: D01444
Carvedilol (DG00321): D00255 D03415
Dapiprazole (DG01140): D03648 D07775
Dihydroergocristine (DG00284): D07833 D07834
Dipivefrine (DG01129): D01017 D02349
Domazoline fumarate: D03887
Doxazosin (DG00256): D00608 D07874
Dronedarone (DG00207): D02537 D03914
Droperidol: D00308
Droxidopa: D01277
Ephedrine (DG00227): D00124 D01386 D04018
Epinephrine (DG00013): D00095 D00996 D02149
Epinephryl borate: D04026
Ergoloid mesylates: D02268
Ergometrine (DG00446): D01163 D07905
Ergot alkaloids: D07906
Ergotamine (DG00834): D00679
Etilefrine (DG00210): D01573 D07931
Guanadrel: D08029
Guanadrel sulfate: D00607
Ifenprodil (DG00292): D01445 D08064
Indoramin (DG00254): D04531 D04532
Labetalol (DG00320): D00600 D08106
Levobunolol (DG01136): D01025 D08115
Medroxalol (DG01317): D04888 D04889
Metaraminol (DG00218): D01019 D08192
Methoxamine (DG00219): D01020 D08201
Methylephedrine (DG01229): D01952 D02109 D08206 D09842
Methylergometrine (DG00445): D00680 D08207
Midodrine (DG00224): D01307 D08220
Moxisylyte (DG00287): D01571 D08239
Naftopidil: D01674
Naphazoline (DG01032): D00743 D01021 D08253
Nefazodone (DG00953): D00819 D08257
Nicergoline (DG00283): D01290 D08271
Nipradilol: D01691
Norepinephrine (DG00212): D00076 D05206 D08284 D09794
Octodrine: D05228
Olanzapine (DG00898): D00454 D06623
Pelanserin hydrochloride: D05395
Periciazine: D01485
Phenoxybenzamine (DG00285): D00507 D08358
Phentolamine (DG00280): D00509 D08362
Phenylephrine (DG00215): D00511 D08365 D08366 D08966
Phenylpropanolamine (DG01041): D01224 D05466 D08368
Prazosin (DG00253): D00609 D08411
Propylhexedrine (DG01919): D05637
Pseudoephedrine (DG01042): D00485 D05648 D05649 D08449
Racephedrine Hydrochloride: D08982
Tamsulosin (DG00490): D01024 D08560
Terazosin (DG00491): D00610 D08569
Tetryzoline (DG01030): D00756 D01023 D08578
Tolazoline (DG00281): D00997 D08614
Tramazoline (DG01033): D01347 D08624
Trimazosin (DG00255): D06234 D08212
Urapidil (DG00257): D01333 D08662
Xylometazoline (DG01031): D00757 D08684
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    147 (ADRA1B)
   04022 cGMP - PKG signaling pathway
    147 (ADRA1B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    147 (ADRA1B)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    147 (ADRA1B)
   04270 Vascular smooth muscle contraction
    147 (ADRA1B)
  Digestive system
   04970 Salivary secretion
    147 (ADRA1B)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    147 (ADRA1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv Shisa
Motif
Other DBs
NCBI-GeneID: 147
NCBI-ProteinID: NP_000670
OMIM: 104220
HGNC: 278
Ensembl: ENSG00000170214
Vega: OTTHUMG00000130327
Pharos: P35368(Tclin)
UniProt: P35368
Position
5q33.3
AA seq 520 aa AA seqDB search
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgacctggacaccggccacaacacatcagcacctgcccactggggagagttg
aaaaatgccaacttcactggccccaaccagacctcgagcaactccacactgccccagctg
gacatcaccagggccatctctgtgggcctggtgctgggcgccttcatcctctttgccatc
gtgggcaacatcctagtcatcttgtctgtggcctgcaaccggcacctgcggacgcccacc
aactacttcattgtcaacctggccatggccgacctgctgttgagcttcaccgtcctgccc
ttctcagcggccctagaggtgctcggctactgggtgctggggcggatcttctgtgacatc
tgggcagccgtggatgtcctgtgctgcacagcgtccattctgagcctgtgcgccatctcc
atcgatcgctacatcggggtgcgctactctctgcagtatcccacgctggtcacccggagg
aaggccatcttggcgctgctcagtgtctgggtcttgtccaccgtcatctccatcgggcct
ctccttgggtggaaggagccggcacccaacgatgacaaggagtgcggggtcaccgaagaa
cccttctatgccctcttctcctctctgggctccttctacatccctctggcggtcattcta
gtcatgtactgccgtgtctatatagtggccaagagaaccaccaagaacctagaggcagga
gtcatgaaggagatgtccaactccaaggagctgaccctgaggatccattccaagaacttt
cacgaggacacccttagcagtaccaaggccaagggccacaaccccaggagttccatagct
gtcaaactttttaagttctccagggaaaagaaagcagctaagacgttgggcattgtggtc
ggtatgttcatcttgtgctggctacccttcttcatcgctctaccgcttggctccttgttc
tccaccctgaagccccccgacgccgtgttcaaggtggtgttctggctgggctacttcaac
agctgcctcaaccccatcatctacccatgctccagcaaggagttcaagcgcgctttcgtg
cgcatcctcgggtgccagtgccgcggccgcggccgccgccgacgccgccgccgccgtcgc
ctgggcggctgcgcctacacctaccggccgtggacgcgcggcggctcgctggagcgctcg
cagtcgcgcaaggactcgctggacgacagcggcagctgcctgagcggcagccagcggacc
ctgccctcggcctcgccgagcccgggctacctgggccgcggcgcgccaccgccagtcgag
ctgtgcgccttccccgagtggaaggcgcccggcgccctcctgagcctgcccgcgcctgag
ccccccggccgccgcggccgccacgactcgggcccgctcttcaccttcaagctcctgacc
gagcccgagagccccgggaccgacggcggcgccagcaacggaggctgcgaggccgcggcc
gacgtggccaacgggcagccgggcttcaaaagcaacatgcccctggcgcccgggcagttt
tag

DBGET integrated database retrieval system