KEGG   Homo sapiens (human): 147015Help
Entry
147015            CDS       T01001                                 

Gene name
DHRS13, SDR7C5
Definition
(RefSeq) dehydrogenase/reductase 13
  KO
K11169  dehydrogenase/reductase SDR family member 13 [EC:1.1.-.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    147015 (DHRS13)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     147015 (DHRS13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 147015
NCBI-ProteinID: NP_653284
OMIM: 616157
HGNC: 28326
Ensembl: ENSG00000167536
Vega: OTTHUMG00000132678
Pharos: Q6UX07(Tdark)
UniProt: Q6UX07
Position
17q11.2
AA seq 377 aa AA seqDB search
MEALLLGAGLLLGAYVLVYYNLVKAPPCGGMGNLRGRTAVVTGANSGIGKMTALELARRG
ARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILI
HNAGISSCGRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVASAAHCRGRLDF
KRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATGVTCYAAHPGPVNSELFLRHVP
GWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAA
HRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLS
KMTHRIQAKVEPEIQLS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctgctgctgggcgcggggttgctgctgggcgcttacgtgcttgtctactac
aacctggtgaaggccccgccgtgcggcggcatgggcaacctgcggggccgcacggccgtg
gtcacgggcgccaacagcggcatcggaaagatgacggcgctggagctggcgcgccgggga
gcgcgcgtggtgctggcctgccgcagccaggagcgcggggaggcggctgccttcgacctc
cgccaggagagtgggaacaatgaggtcatcttcatggccttggacttggccagtctggcc
tcggtgcgggcctttgccactgcctttctgagctctgagccacggttggacatcctcatc
cacaatgccggtatcagttcctgtggccggacccgtgaggcgtttaacctgctgcttcgg
gtgaaccatatcggtccctttctgctgacacatctgctgctgccttgcctgaaggcatgt
gcccctagccgcgtggtggtggtagcctcagctgcccactgtcggggacgtcttgacttc
aaacgcctggaccgcccagtggtgggctggcggcaggagctgcgggcatatgctgacact
aagctggctaatgtactgtttgcccgggagctcgccaaccagcttgaggccactggcgtc
acctgctatgcagcccacccagggcctgtgaactcggagctgttcctgcgccatgttcct
ggatggctgcgcccacttttgcgcccattggcttggctggtgctccgggcaccaagaggg
ggtgcccagacacccctgtattgtgctctacaagagggcatcgagcccctcagtgggaga
tattttgccaactgccatgtggaagaggtgcctccagctgcccgagacgaccgggcagcc
catcggctatgggaggccagcaagaggctggcagggcttgggcctggggaggatgctgaa
cccgatgaagacccccagtctgaggactcagaggccccatcttctctaagcaccccccac
cctgaggagcccacagtttctcaaccttaccccagccctcagagctcaccagatttgtct
aagatgacgcaccgaattcaggctaaagttgagcctgagatccagctctcctaa

DBGET integrated database retrieval system