KEGG   Homo sapiens (human): 147179
Entry
147179            CDS       T01001                                 

Gene name
WIPF2, WICH, WIRE
Definition
(RefSeq) WAS/WASL interacting protein family member 2
  KO
K19475  WAS/WASL-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa05130  Pathogenic Escherichia coli infection
hsa05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    147179 (WIPF2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    147179 (WIPF2)
   05135 Yersinia infection
    147179 (WIPF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    147179 (WIPF2)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    147179 (WIPF2)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 147179
NCBI-ProteinID: NP_573571
OMIM: 609692
HGNC: 30923
Ensembl: ENSG00000171475
Vega: OTTHUMG00000133331
Pharos: Q8TF74(Tbio)
UniProt: Q8TF74
Position
17q21.2
AA seq 440 aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRS
APILEKPKGSSGGYGSGGAALQPKGGLFQGGVLKLRPVGAKDGSENLAGKPALQIPSSRA
AAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIR
TGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPT
SASPSLLSNRPPPPARDPPSRGAAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPP
PPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQRI
YPSKTNRAARGAPPLPPILR
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgccaattcctcctcccccgccacccccacctggtcctcctccacctcccacatttcat
caggcaaacacagagcagcccaagctgagtagagatgagcagcggggtcgaggcgccctc
ttacaggacatttgcaaagggaccaagctgaagaaggtgaccaacattaatgatcggagt
gctcccatcctcgagaagccgaaaggaagcagtggtggctatggctctggaggagctgcc
ctgcagcccaagggaggtctcttccaaggaggagtgctgaagcttcgacctgtgggagcc
aaggatggttcagagaacctagctggtaagccagccctgcaaatccccagttctcgagct
gctgccccaaggcctccagtatctgccgccagcgggcgtcctcaggatgatacagacagc
agccgggcctcactcccagaactgccccggatgcagagaccctctttaccggacctctct
cggcctaataccaccagcagtacgggcatgaagcacagctcctctgcccctcccccacca
cccccagggcggcgtgccaacgcaccccccacacctctgcctatgcacagcagcaaagcc
cccgcctacaacagagagaaacccttgccaccgacgcctggacaaaggcttcaccctggt
cgagagggacctcctgctccacccccagtcaaaccacctccttcccctgtgaatatcaga
acaggaccaagtggccagtctctggctcctcctcctccgccttaccgccagcctcctggg
gtccccaatggaccctctagccccactaatgagtcagcccctgagctgccacagagacac
aattctttgcataggaagacaccagggcctgtcagaggcctagcacctcctccacccacc
tcggcctccccatctttactgagtaataggccacctcccccagcccgagaccctcccagt
cggggagcagctcctccacccccaccacctgtgatccgaaatggtgccagggatgctccc
cctcccccaccaccataccgaatgcatgggtcagaacccccgagccgaggaaagccccca
cctccaccctcaaggacgccagctgggccaccccctcctcctccaccgcccctgaggaat
ggccacagagattctatcaccactgtccggtctttcttggatgattttgagtcaaagtat
tccttccatccagtagaagactttcctgctccagaagaatataaacactttcagaggata
tatcccagcaaaacaaaccgagctgcccgtggagccccacctctgccacccattctcagg
tga

DBGET integrated database retrieval system