KEGG   Homo sapiens (human): 147183
Entry
147183            CDS       T01001                                 
Symbol
KRT25, ARWH3, KRT24IRS1, KRT25A
Name
(RefSeq) keratin 25
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Disease
H00667  Woolly hair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    147183 (KRT25)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    147183 (KRT25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    147183 (KRT25)
   04147 Exosome [BR:hsa04147]
    147183 (KRT25)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     147183 (KRT25)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   147183 (KRT25)
  Exosomal proteins of other body fluids (saliva and urine)
   147183 (KRT25)
  Exosomal proteins of colorectal cancer cells
   147183 (KRT25)
  Exosomal proteins of melanoma cells
   147183 (KRT25)
SSDB
Motif
Pfam: Filament Phage_Mu_Gam TPR_MLP1_2
Other DBs
NCBI-GeneID: 147183
NCBI-ProteinID: NP_853512
OMIM: 616646
HGNC: 30839
Ensembl: ENSG00000204897
Pharos: Q7Z3Z0(Tbio)
UniProt: Q7Z3Z0 Q6ZPD6
Position
17:complement(40748021..40755542)
AA seq 450 aa
MSLRLSSASRRSCPRPTTGSLRLYGGGTSFGTGNSCGISGIGSGFSSAFGGSSSGGNTGG
GNPCAGFTVNERGLLSGNEKVTMQNLNDRLASYLDSVHALEEANADLEQKIKGWYEKFGP
GSCRGLDHDYSRYFPIIDDLKNQIIASTTSNANAVLQIDNARLTADDFRLKYENELALHQ
SVEADVNGLRRVLDEITLCRTDLEIQYETLSEEMTYLKKNHKEEMQVLQCAAGGNVNVEM
NAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISEDVGATTSARNELT
EMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQVRTETE
GQKLEYEQLLDIKLHLEKEIETYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAI
VVKKVLEEVDQRSKILTTRLHSLEEKSQSN
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgtctcttcgactttccagtgcatccaggaggtcctgtcctcgtcccaccactggatca
ctcagactctatggtgggggaaccagctttggtactggaaattcttgtggcatttcaggg
attggaagtggcttctctagtgccttcggaggcagctcatcgggaggaaacacaggggga
ggtaatccctgtgctggcttcactgtgaatgagcgggggctcctttctggcaatgagaag
gtgaccatgcagaacctcaatgaccgcctggcatcctacctggacagtgtgcatgctctg
gaggaggccaacgctgacctggagcagaagatcaagggctggtatgagaaatttgggcct
ggctcttgccgtggtcttgatcatgactatagcagatatttcccaataattgatgacctt
aaaaatcagatcatcgcatccaccaccagcaatgctaatgctgttctgcagatcgataat
gccaggcttacagctgatgatttcagactcaagtatgaaaatgagctggctcttcaccag
agtgtagaggctgatgtcaatgggttacgaagagttttggatgaaataaccctgtgcaga
acagatctggagattcagtatgaaaccctgagtgaggagatgacttacctcaaaaagaac
cataaagaggaaatgcaagttctgcagtgcgcagctggaggcaacgtgaacgtggagatg
aacgcagcccccggggtggacctcacagttctgctgaacaacatgcgagctgagtacgaa
gcccttgcagagcagaaccgcagggacgcggaggcctggttcaacgagaagagcgcctcc
ctgcagcagcagatctctgaggatgtcggagccacaacctcagcccggaatgagctgact
gaaatgaagcgcactcttcaaaccctggaaattgaacttcagtctctcctagccacgaaa
cactccctggagtgctccttgacagagaccgagagcaactactgtgcgcagctggcgcag
atccaggctcagatcggggccctggaggagcagctgcaccaggtcagaaccgagaccgag
ggccagaagctggagtatgagcagctcctggacatcaagctccacctggaaaaagaaatt
gagacctactgtctccttataggaggagatgatggagcctgtaagtctgggggttacaag
tctaaagattatggatctggaaatgtgggaagtcaagtcaaagacccagccaaagccata
gtggttaagaaagttcttgaggaggtagaccaacgcagcaaaatacttaccaccaggctc
cactccctggaagagaaatctcaaagcaattaa

DBGET integrated database retrieval system