KEGG   Homo sapiens (human): 1473
Entry
1473              CDS       T01001                                 
Symbol
CST5
Name
(RefSeq) cystatin D
  KO
K13901  cystatin-D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    1473 (CST5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1473 (CST5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I25: cystatin family
   1473 (CST5)
SSDB
Motif
Pfam: Cystatin SQAPI
Other DBs
NCBI-GeneID: 1473
NCBI-ProteinID: NP_001891
OMIM: 123858
HGNC: 2477
Ensembl: ENSG00000170367
Pharos: P28325(Tbio)
UniProt: P28325
Structure
Position
20:complement(23875934..23879748)
AA seq 142 aa
MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVIN
KDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCS
FQINEVPWEDKISILNYKCRKV
NT seq 429 nt   +upstreamnt  +downstreamnt
atgatgtggcccatgcacaccccactgctgctgctgactgccttgatggtggccgtggcc
gggagtgcctcggcccaatctaggaccttggcaggtggcatccatgccacagacctcaat
gacaagagtgtgcagtgtgccctggactttgccatcagcgagtacaacaaggtcattaat
aaggatgagtactacagccgccctctgcaggtgatggctgcctaccagcagatcgtgggt
ggggtgaactactacttcaatgtgaagttcggtcgaaccacatgcaccaagtcccagccc
aacttggacaactgtcccttcaatgaccagccaaaactgaaagaggaagagttctgctct
ttccagatcaatgaagttccctgggaggataaaatttccattctgaactacaagtgccgg
aaagtctag

DBGET integrated database retrieval system