KEGG   Homo sapiens (human): 147339
Entry
147339            CDS       T01001                                 
Symbol
C18orf25, ARKL1, Ark2N, RNF111L1
Name
(RefSeq) chromosome 18 open reading frame 25
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: RNF111_N DddA-like
Other DBs
NCBI-GeneID: 147339
NCBI-ProteinID: NP_659492
HGNC: 28172
Ensembl: ENSG00000152242
Pharos: Q96B23(Tdark)
UniProt: Q96B23
Position
18:46173553..46266992
AA seq 404 aa
MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADSTVISSMPCLLM
ELRRDSSESQLASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSAEENEPSQA
ETAVEGDPSGVSGATVGRKSRRSRSESETSTMAAKKNRQSSDKQNGRVAKVKGHRSQKHK
ERIRLLRQKREAAARKKYNLLQDSSTSDSDLTCDSSTSSSDDDEEVSGSSKTITAEIPDG
PPVVAHYDMSDTNSDPEVVNVDNLLAAAVVQEHSNSVGGQDTGATWRTSGLLEELNAEAG
HLDPGFLASDKTSAGNAPLNEEINIASSDSEVEIVGVQEHARCVHPRGGVIQSVSSWKHG
SGTQYVSTRQTQSWTAVTPQQTWASPAEVVDLTLDEDSRRKYLL
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgaagatggaggaggcagtgggaaaagttgaagaactcattgagtccgaagccccacca
aaagcatctgaacaagagacagccaaggaggaagatggatctgtagaactggaatctcaa
gttcagaaagatggtgtagcggattctacagttatttcttcaatgccctgcttgttgatg
gaactgagaagggactcttctgagtctcagttagcatccacagagagtgacaagcctaca
actggccgagtttatgagagtgactcctctaatcactgcatgctttccccttcctctagt
ggtcacctggctgattcagatacgttgtcttccgcagaagagaatgaaccctctcaggca
gaaacggcggtagaaggagacccttcaggagtgtctggtgccacagttgggcgcaagtct
aggcggtcccgatctgaaagtgaaacttccactatggctgccaagaaaaaccggcaatcc
agtgataaacagaatggccgagtcgccaaggttaaaggtcatcggagccaaaagcacaag
gagaggatcaggctactgaggcagaaacgggaggctgctgcaaggaagaaatataacctg
ctgcaggacagtagtaccagtgatagtgacctgacttgtgactcaagcacgagctcatca
gatgatgatgaagaggtttcagggagcagcaagacaatcactgcagagataccagatgga
cctccagttgtagctcattatgatatgtctgacaccaactctgacccagaagtggtaaat
gtggacaatttattggcggctgcagtagttcaagagcacagtaattctgtaggcggccag
gacacaggagctacctggaggaccagcgggcttctagaggagctgaatgcagaggcaggt
catttggatccaggattcctagcaagtgacaaaacatctgctggcaatgcgccactcaat
gaagaaattaacattgcgtcttcagatagtgaagtagagattgtgggagttcaggaacat
gcaaggtgtgttcatcctcgaggtggtgtgattcagagtgtttcttcatggaagcatggc
tcgggcacgcagtatgttagcaccaggcaaacacagtcatggactgctgtgactccccag
cagacttgggcttcaccagcagaagttgttgaccttaccttggatgaggatagcaggcgt
aaatacctactgtaa

DBGET integrated database retrieval system