KEGG   Homo sapiens (human): 147407
Entry
147407            CDS       T01001                                 
Symbol
SLC25A52, MCART2
Name
(RefSeq) solute carrier family 25 member 52
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 147407
NCBI-ProteinID: NP_001029344
OMIM: 616153
HGNC: 23324
Ensembl: ENSG00000141437
Pharos: Q3SY17(Tdark)
UniProt: Q3SY17 I3L0B8
Position
18:complement(31759584..31760880)
AA seq 297 aa
MIDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITYPIQKVLFRQQL
YGIKTRDAVLQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLRKHVRAPEFAT
HGVAAVLAGTAEAIFTPLERVQTLLQNHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPIL
FRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFIGGGLLGAMLGFLCFPINVVKTRLQ
SQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKFI
NT seq 894 nt   +upstreamnt  +downstreamnt
atgatagattcagaagctcatgaaaagaggccaccaatacttacatcttcaaaacaagat
atatcacctcatattacaaatgttggtgaaatgaagcattacttgtgtggctgctgtgca
gccttcaacaacgtcgcaatcacatatcccattcagaaggtcctctttcggcaacagctg
tatggcatcaaaacccgggatgcagtacttcagttgagaagggatggatttcgaaatttg
tatcgtggaatccttcccccattgatgcagaagacaactacgcttgcacttatgtttggt
ctgtatgaggatttatcctgccttctccggaagcatgtccgtgctccagagtttgcaacc
catggcgtggcggcagtgcttgcagggacagcagaagcaattttcactccactggaaaga
gttcagacattgcttcaaaaccacaagcatcatgacaaatttaccaacacttatcaggct
ttcaaggcactgaaatgtcatggaattggagagtattatcgaggcttggtgcccattctt
ttccggaatggactcagcaatgtcttgtttttcggccttcgaggtcccattaaggagcat
ctgcctaccgcaacgactcacagtgctcatttggtcaatgattttatcggtggaggtcta
ttgggtgccatgttgggattcttgtgttttccaattaatgttgtaaaaactcgcctacag
tctcagattggtggggaatttcagtctttccccaaggttttccaaaaaatctggctggaa
cgggacagaaaactgataaatcttttcagaggtgcccatctgaattaccatcggtccctc
atctcttggggcataatcaatgcaacttatgagttcttgttaaaatttatatga

DBGET integrated database retrieval system