KEGG   Homo sapiens (human): 147463
Entry
147463            CDS       T01001                                 
Symbol
ANKRD29
Name
(RefSeq) ankyrin repeat domain 29
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 147463
NCBI-ProteinID: NP_775776
HGNC: 27110
Ensembl: ENSG00000154065
Pharos: Q8N6D5(Tdark)
UniProt: Q8N6D5
Position
18:complement(23598926..23662911)
AA seq 301 aa
MCRMSFKKETPLANAAFWAARRGNLALLKLLLNSGRVDVDCRDSHGTTLLMVAAYAGHID
CVRELVLQGADINLQRESGTTALFFAAQQGHNDVVRFLFGFGASTEFRTKDGGTALLAAS
QYGHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPRQDGTA
PLWIASQMGHSEVVRVMLLRGADRDAARNDGTTALLKAANKGYNDVIKELLKFSPTLGIL
KNGTSALHAAVLSGNIKTVALLLEAGADPSLRNKANELPAELTKNERILRLLRSKEGPRK
S
NT seq 906 nt   +upstreamnt  +downstreamnt
atgtgcaggatgtccttcaagaaggaaactccacttgccaatgctgcattctgggcagcc
aggagaggaaacctggcgctgctgaagctgctgttgaacagcggccgggtggacgtggac
tgcagagacagccatggcaccacactcctgatggttgctgcctacgctggccacatagac
tgtgtgagggaactggttctgcaaggagcagacatcaatctccagagagagtcaggtaca
actgccctattctttgccgcccagcaaggccataatgatgtcgtgagatttctctttgga
tttggagcatccactgaatttaggaccaaagacgggggcaccgccctgttggctgccagt
cagtacgggcacatgcaggtggtggagaccttgctgaagcacggagcaaacatccatgac
caactttatgatggagccactgccctcttcctagctgcccaaggtggttacttggatgtt
attcgattactgctggcttcaggagcaaaagtcaaccagccaaggcaggacgggacagcg
cccctgtggatcgcgtcccagatgggccacagcgaggtggtgcgggtgatgctgctgcgc
ggagccgaccgcgacgctgcgcggaacgatggcacaacagcattattgaaagcagccaac
aaagggtataatgatgtcataaaagagttgcttaaattctcacccactcttggtattttg
aagaatgggacatcagcgctccatgcagcagtgctcagtggaaacattaaaacagttgcg
ctgctcctagaagcaggggcagacccatccctgagaaacaaggccaatgaacttccggca
gaactaaccaaaaatgaacgtatattgcgtctcctgagaagtaaagaaggtcccagaaag
agctaa

DBGET integrated database retrieval system