KEGG   Homo sapiens (human): 147495Help
Entry
147495            CDS       T01001                                 

Gene name
APCDD1, B7323, DRAPC1, FP7019, HHS, HTS, HYPT1
Definition
(RefSeq) APC down-regulated 1
Organism
hsa  Homo sapiens (human)
Disease
H00786  Hereditary hypotrichosis simplex
SSDB OrthologParalogGFIT
Motif
Pfam: APCDDC
Motif
Other DBs
NCBI-GeneID: 147495
NCBI-ProteinID: NP_694545
OMIM: 607479
HGNC: 15718
Ensembl: ENSG00000154856
Vega: OTTHUMG00000131635
Pharos: Q8J025(Tbio)
UniProt: Q8J025
Position
18p11.22
AA seq 514 aa AA seqDB search
MSWPRRLLLRYLFPALLLHGLGEGSALLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLH
NGARITVQMPPTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTY
TLIIRGKIRLRQASWIIRGGTEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGP
WVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDAT
QRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRC
EVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGT
EFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHT
EYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDS
GSSLYGRAPGRHTWSLLLAALACLVPLLHWNIRR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggccgcgccgcctcctgctcagatacctgttcccggccctcctgcttcacggg
ctgggagagggttctgccctccttcatccagacagcaggtctcatcctaggtccttagag
aaaagtgcctggagggcttttaaggagtcacagtgccatcacatgctcaaacatctccac
aatggtgcaaggatcacagtgcagatgccacctacaatcgagggccactgggtctccaca
ggctgtgaagtaaggtcaggcccagagttcatcacaaggtcctacagattctaccacaat
aacaccttcaaggcctaccaattttattatggcagcaaccggtgcacaaatcccacttat
actctcatcatccggggcaagatccgcctccgccaggcctcctggatcatccgagggggc
acggaagccgactaccagctgcacaacgtccaggtgatctgccacacagaggcggtggcc
gagaagctcggccagcaggtgaaccgcacatgcccgggcttcctcgcagacgggggtccc
tgggtgcaggacgtggcctatgacctctggcgagaggagaacggctgtgagtgcaccaag
gccgtgaactttgccatgcatgaacttcagctcatccgggtggagaagcagtaccttcac
cacaacctcgaccacctggtcgaggagctcttccttggtgacattcacactgatgccacc
cagaggatgttctaccggccctccagttaccagccccctctgcagaatgccaagaaccac
gaccatgcctgcatcgcctgtcggatcatctatcggtcagacgagcaccaccctcccatc
ctgcccccaaaggcagacctgaccatcggcctgcacggggagtgggtgagccagcgctgt
gaggtgcgccccgaagtcctcttcctcacccgccacttcatcttccatgacaacaacaac
acctgggagggccactactaccactactcagacccggtgtgcaagcaccccaccttctcc
atctacgcccggggccgctacagccgcggcgtcctctcgtccagggtcatgggaggcacc
gagttcgtgttcaaagtgaatcacatgaaggtcacccccatggatgcggccacagcctca
ctgctcaacgtcttcaacgggaatgagtgcggggccgagggctcctggcaggtgggcatc
cagcaggatgtgacccacaccaatggctgcgtggccctgggcatcaaactacctcacacg
gagtacgagatcttcaaaatggaacaggatgcccgggggcgctatctgctgttcaacggt
cagaggcccagcgacgggtccagcccagacaggccagagaagagagccacgtcctaccag
atgcccttggtccagtgtgcctcctcttcgccgagggcagaggacctcgcagaagacagt
ggaagcagcctgtatggccgggcccctgggaggcacacctggtccctgctgctggctgca
cttgcctgccttgtccctctgctgcattggaacatccgcagatag

DBGET integrated database retrieval system