KEGG   Homo sapiens (human): 1475
Entry
1475              CDS       T01001                                 

Symbol
CSTA, AREI, PSS4, STF1, STFA
Name
(RefSeq) cystatin A
  KO
K13907  cystatin-A/B
Organism
hsa  Homo sapiens (human)
Disease
H00737  Peeling skin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1475 (CSTA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1475 (CSTA)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I25: cystatin family
   1475 (CSTA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1475 (CSTA)
SSDB
Motif
Pfam: Cystatin SQAPI Afaf
Other DBs
NCBI-GeneID: 1475
NCBI-ProteinID: NP_005204
OMIM: 184600
HGNC: 2481
Ensembl: ENSG00000121552
Vega: OTTHUMG00000159488
Pharos: P01040(Tbio)
UniProt: P01040
Structure
PDB: 

Position
3q21.1
AA seq 98 aa
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAG
DNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
NT seq 297 nt   +upstreamnt  +downstreamnt
atgatacctggaggcttatctgaggccaaacccgccactccagaaatccaggagattgtt
gataaggttaaaccacagcttgaagaaaaaacaaatgagacttacggaaaattggaagct
gtgcagtataaaactcaagttgttgctggaacaaattactacattaaggtacgagcaggt
gataataaatatatgcacttgaaagtattcaaaagtcttcccggacaaaatgaggacttg
gtacttactggataccaggttgacaaaaacaaggatgacgagctgacgggcttttag

DBGET integrated database retrieval system