KEGG   Homo sapiens (human): 1476
Entry
1476              CDS       T01001                                 

Gene name
CSTB, CPI-B, CST6, EPM1, EPM1A, PME, STFB, ULD
Definition
(RefSeq) cystatin B
  KO
K13907  cystatin-A/B
Organism
hsa  Homo sapiens (human)
Disease
H00810  Progressive myoclonic epilepsy
H01995  Unverricht-Lundborg disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1476 (CSTB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1476 (CSTB)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I25: cystatin family
   1476 (CSTB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1476 (CSTB)
SSDB
Motif
Pfam: Cystatin Dynein_light SQAPI
Other DBs
NCBI-GeneID: 1476
NCBI-ProteinID: NP_000091
OMIM: 601145
HGNC: 2482
Ensembl: ENSG00000160213
Vega: OTTHUMG00000086886
Pharos: P04080(Tbio)
UniProt: P04080 Q76LA1
Structure
PDB: 
2OCT 4N6V 1STF

Position
21q22.3
AA seq 98 aa
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVG
DEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
NT seq 297 nt   +upstreamnt  +downstreamnt
atgatgtgcggggcgccctccgccacgcagccggccaccgccgagacccagcacatcgcc
gaccaggtgaggtcccagcttgaagagaaagaaaacaagaagttccctgtgtttaaggcc
gtgtcattcaagagccaggtggtcgcggggacaaactacttcatcaaggtgcacgtcggc
gacgaggacttcgtacacctgcgagtgttccaatctctccctcatgaaaacaagcccttg
accttatctaactaccagaccaacaaagccaagcatgatgagctgacctatttctga

DBGET integrated database retrieval system