KEGG   Homo sapiens (human): 147694
Entry
147694            CDS       T01001                                 

Gene name
ZNF548
Definition
(RefSeq) zinc finger protein 548
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147694 (ZNF548)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147694 (ZNF548)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147694 (ZNF548)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 C1_1 zinc_ribbon_15 XPA_N zf_UBZ
Other DBs
NCBI-GeneID: 147694
NCBI-ProteinID: NP_690873
HGNC: 26561
Ensembl: ENSG00000188785
Vega: OTTHUMG00000183281
Pharos: Q8NEK5(Tdark)
UniProt: Q8NEK5
Position
19q13.43
AA seq 533 aa
MNLTEGRVVFEDVAIYFSQEEWGHLDEAQRLLYRDVMLENLALLSSLGSWHGAEDEEAPS
QQGFSVGVSEVTASKPCLSSQKVHPSETCGPPLKDILCLVEHNGIHPEQHIYICEAELFQ
HPKQQIGENLSRGDDWIPSFGKNHRVHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKP
YRDTEDREAFQTGQNDYKCSECGKTFTCSYSFVEHQKIHTGERSYECNKCGKFFKYSANF
MKHQTVHTSERTYECRECGKSFMYNYRLMRHKRVHTGERPYECNTCGKFFRYSSTFVRHQ
RVHTGERPYECRECGKFFMDSSTLIKHQRVHTGERPYKCNDCGKFFRYISTLIRHQRIHT
GERPYECSVCGELFRYNSSLVKHWRNHTGERPYKCSECGKSFRYHCRLIRHQRVHTGERP
YECSECGKFFRYNSNLIKHWRNHTGERPYECRECGKAFSHKHILVEHQKIHSGERPYECS
ECQKAFIRKSHLVHHQKIHSEERLVCSMNVGNSLAKTPTSLNIRDFTMEKVYH
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgaacctgactgagggccgtgtggtctttgaggacgtggccatatatttctcccaggag
gagtgggggcaccttgatgaggctcagagattgctgtaccgtgatgtgatgctggagaat
ttggcccttttgtcctcactaggttcttggcatggagctgaggatgaggaggcaccttca
cagcaaggtttttctgtaggagtgtcagaggttacagcttcaaagccctgtctgtccagc
cagaaggtccaccctagtgagacatgtggcccacccttgaaagacattctgtgcctggtt
gagcacaatggaattcatcctgagcaacacatatatatttgtgaggcagagctttttcag
cacccaaagcagcaaattggagaaaatctttccagaggggatgattggataccttcattt
gggaagaaccacagagttcacatggcagaggagatcttcacatgcatggagggctggaag
gacttaccagccacctcatgccttctccagcaccagggccctcaaagcgagtggaagcca
tacagggacacagaggacagagaagcctttcagactggacaaaatgattacaaatgtagt
gaatgtgggaaaaccttcacctgcagctattcatttgttgagcaccagaaaatccacaca
ggagaaaggtcttatgaatgtaacaaatgtgggaaattctttaagtacagtgccaatttc
atgaaacatcagacagttcacactagtgaaaggacttatgagtgcagagaatgtggaaaa
tcctttatgtacaactaccgactcatgagacataagcgagttcacactggagaaaggcct
tatgagtgcaacacatgtgggaaattctttcggtacagctccacatttgttagacatcag
agagttcacaccggagaaaggccgtatgagtgcagggaatgtgggaaattctttatggac
agctccacactcattaaacatcagagagttcacaccggagaaagaccttataagtgcaat
gattgtgggaaattttttaggtatatctccacactcattagacatcagagaattcacact
ggagaaaggccttatgagtgcagtgtatgtggggaattgtttaggtacaactccagcctt
gttaaacattggagaaatcacactggagaaaggccttataaatgcagtgaatgtgggaaa
tcatttaggtaccactgcaggctcattagacaccagagagtccacacgggagaaaggcct
tatgagtgcagcgaatgcgggaaattctttcgttacaactccaacctcattaaacattgg
agaaatcacactggagaaaggccttacgagtgcagagagtgtgggaaagcctttagccac
aagcatatacttgttgagcaccagaaaatccacagtggagaaagaccttatgagtgcagc
gaatgccagaaggcctttattagaaagtctcacctggttcatcaccagaaaatccacagt
gaagagaggcttgtgtgctccatgaatgtggggaattctttagctaaaactccaacctca
ttaaacatcagagatttcacaatggagaaagtttaccattga

DBGET integrated database retrieval system