KEGG   Homo sapiens (human): 147700
Entry
147700            CDS       T01001                                 
Symbol
KLC3, KLC2, KLC2L, KLCt, KNS2B
Name
(RefSeq) kinesin light chain 3
  KO
K10407  kinesin light chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06465  Prion disease
  Element
N00978  Anterograde axonal transport
N00979  Mutation-caused aberrant Htt to anterograde axonal transport
N01017  Mutation-caused aberrant PSEN1 to anterograde axonal transport
N01055  Mutation-caused aberrant SNCA to anterograde axonal transport
N01202  Oligomeric conformation PrPc to anterograde axonal transport
N01297  Arl8-regulated microtubule plus-end directed transport
N01298  Salmonella SifA to microtubule plus-end directed transport
N01299  Salmonella PipB2 to microtubule plus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    147700 (KLC3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    147700 (KLC3)
   05012 Parkinson disease
    147700 (KLC3)
   05014 Amyotrophic lateral sclerosis
    147700 (KLC3)
   05016 Huntington disease
    147700 (KLC3)
   05020 Prion disease
    147700 (KLC3)
   05022 Pathways of neurodegeneration - multiple diseases
    147700 (KLC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    147700 (KLC3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    147700 (KLC3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     147700 (KLC3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     147700 (KLC3)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_8 TPR_MalT TPR_19 TPR_17 ANAPC3 SNAP TPR_16 PPR Crescentin PPR_2 RNPP_C DUF3450 Tox-GHH YabA Milton TPR_4
Other DBs
NCBI-GeneID: 147700
NCBI-ProteinID: NP_803136
OMIM: 601334
HGNC: 20717
Ensembl: ENSG00000104892
Pharos: Q6P597(Tbio)
UniProt: Q6P597 A0A024R0V3
Position
19:45340750..45351519
AA seq 504 aa
MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAG
LEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLR
EELEETQRRLRASEESVAQLEEEKRHLEFLGQLRQYDPPAESQQSESPPRRDSLASLFPS
EEEERKGPEAAGAAAAQQGGYEIPARLRTLHNLVIQYAGQGRYEVAVPLCRQALEDLERS
SGHCHPDVATMLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL
YGKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNNLALLCQNQGKFEDVERHYARAL
SIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEILHKEDLPAPLGAPNTGTAG
DAEQALRRSSSLSKIRESIRRGSEKLVSRLRGEAAAGAAGMKRAMSLNTLNVDAPRAPGT
QFPSWHLDKAPRTLSASTQDLSPH
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgtctgtgcaggtagcggctcctggaagtgcagggctgggcccagagcgcctgagccct
gaggagctggtgcggcagacgcggcaagtggtccaggggctggaggcgctgcgggcagag
caccatggcctggctgggcacctggcggaggccctggcgggacagggcccggcagccggc
ttggagatgctggaggaaaagcagcaggtggtgagccactcgctggaggccatcgagctg
gggctgggcgaggcccaggtgctgctggccctgtcggcacatgtgggtgcactggaggca
gagaagcagcggctgcgctcgcaggcccggcggctggcccaggagaacgtgtggctgcgg
gaggaactggaggagacgcagcggcggcttcgggccagcgaggagtccgtggcccagctg
gaggaggagaagcgccacctggagttcctggggcagctgcgacagtacgacccaccggcg
gagagccagcagtctgagtccccgcctcgccgagacagcctggcctccctgttccccagc
gaggaggaggagaggaaaggtcctgaggccgcaggagcagcagctgctcagcagggtggc
tatgagatccctgcccgccttcggaccctgcataacctcgtgatccagtacgcggggcag
ggccgctatgaggtggcggtgcctctgtgccgccaggccttggaggacctggagcgcagc
tcgggccactgccaccctgacgtggccaccatgctcaacatcctggcgctggtgtaccgg
gaccagaacaagtacaaagaagccacagaccttctccatgatgccctgcagatccgggag
cagacgctgggccctgagcaccccgcggtggccgccacgctcaacaacttggctgtcctc
tatgggaagcgtgggcgttaccgggaggcagagcccctgtgccagcgcgctttggagatc
cgagagaaggtcctgggtgctgaccacccagatgtggccaagcagctcaacaacctggcc
ctgctgtgccagaaccagggcaagtttgaggacgtggagcggcactatgcccgggccctg
agcatctatgaggcactgggcgggccccatgaccccaacgtggccaagaccaagaacaac
ctggcctcagcctacctgaaacagaacaagtatcaacaagcggaagagctgtacaaagaa
atcctccacaaggaggacctacccgcccctctcggtgcccccaacacaggcacagctggt
gacgcagaacaggcccttcgccgcagcagctcactctccaagatccgtgagtctatcagg
cgaggaagtgagaagctggtctcccggctccgaggcgaggcggcggcaggagcagccgga
atgaagagagccatgtcactcaacacactgaacgtggatgctccaagggctcctgggact
cagtttcccagctggcacctggacaaggcccctcggaccctcagcgccagcacccaggac
ctgagcccccactaa

DBGET integrated database retrieval system