KEGG   Homo sapiens (human): 147744Help
Entry
147744            CDS       T01001                                 

Gene name
TMEM190, MDAC1
Definition
(RefSeq) transmembrane protein 190
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM190 TEX29
Motif
Other DBs
NCBI-GeneID: 147744
NCBI-ProteinID: NP_631911
HGNC: 29632
Ensembl: ENSG00000160472
Vega: OTTHUMG00000180794
Pharos: Q8WZ59(Tdark)
UniProt: Q8WZ59
Position
19q13.42
AA seq 177 aa AA seqDB search
MLGCGIPALGLLLLLQGSADGNGIQGFFYPWSCEGDIWDRESCGGQAAIDSPNLCLRLRC
CYRNGVCYHQRPDENVRRKHMWALVWTCSGLLLLSCSICLFWWAKRRDVLHMPGFLAGPC
DMSKSVSLLSKHRGTKKTPSTGSVPVALSKESRDVEGGTEGEGTEEGEETEGEEEED
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgttgggctgtgggatcccagcgctgggcctgctcctgctgctgcagggctcggcagac
ggaaatggaatccagggattcttctacccatggagctgtgagggtgacatatgggaccgg
gagagctgtgggggccaggcggccatcgatagccccaacctctgcctgcgtctccggtgc
tgctaccgcaatggggtctgctaccaccagcgtccagacgaaaacgtgcggaggaagcac
atgtgggcgctggtctggacgtgcagcggcctcctcctcctgagctgcagcatctgcttg
ttctggtgggccaagcgccgggacgtgctgcatatgcccggtttcctggcgggtccgtgt
gacatgtccaagtccgtctcgctgctctccaagcaccgagggaccaagaagacgccgtcc
acgggcagcgtgccagtcgccctgtccaaagagtccagggatgtggagggaggcaccgag
ggggaagggacggaggagggtgaggagacagagggcgaggaagaggaggattag

DBGET integrated database retrieval system