KEGG   Homo sapiens (human): 147841Help
Entry
147841            CDS       T01001                                 

Gene name
SPC24, SPBC24
Definition
(RefSeq) SPC24, NDC80 kinetochore complex component
  KO
K11549  kinetochore protein Spc24, animal type
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    147841 (SPC24)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     NDC80 complex
      147841 (SPC24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spc24 Myosin_tail_1 DUF489 PilO Lipoprotein_20 Spc7 YabA TMF_TATA_bd UPF0242
Motif
Other DBs
NCBI-GeneID: 147841
NCBI-ProteinID: NP_872319
OMIM: 609394
HGNC: 26913
Ensembl: ENSG00000161888
Vega: OTTHUMG00000180798
Pharos: Q8NBT2(Tdark)
UniProt: Q8NBT2
Position
19p13.2
AA seq 197 aa AA seqDB search
MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEK
EVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLER
QEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQL
SRKFISDYLWSLVDTEW
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggccgccttccgcgacatagaggaggtgagccaggggctgctcagcctgctgggcgcc
aaccgcgcggaggcgcagcagcgacggctgctggggcgccacgagcaggtggtggagcgg
ctgctggaaacgcaagacggtgccgagaagcagctgcgagagatcctcaccatggagaag
gaagtggcccagagccttctcaatgcgaaggagcaggtgcaccagggaggcgtggagctg
cagcagctggaagctgggcttcaggaggctggggaggaggacacccgtctgaaggccagc
ctccttcagctcaccagagagctggaagagctcaaggagattgaggcggatctggagcga
caggagaaggaggtcgacgaggacacgacagtcacaatcccctcggccgtgtacgtggct
caactttaccaccaagttagtaaaattgagtgggattatgagtgtgagccagggatggtc
aaaggcatccatcatggccccagtgtggcccagcccatccacctggacagcacccagctc
tccaggaaattcatcagcgactacctctggagtctggtggacaccgagtggtag

DBGET integrated database retrieval system