KEGG   Homo sapiens (human): 147968
Entry
147968            CDS       T01001                                 
Symbol
CAPN12
Name
(RefSeq) calpain 12
  KO
K04740  calpain-12 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    147968 (CAPN12)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-
     147968 (CAPN12)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C2: calpain family
   147968 (CAPN12)
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_6
Other DBs
NCBI-GeneID: 147968
NCBI-ProteinID: NP_653292
OMIM: 608839
HGNC: 13249
Ensembl: ENSG00000182472
Pharos: Q6ZSI9(Tdark)
UniProt: Q6ZSI9
Position
19:complement(38730192..38744693)
AA seq 719 aa
MASSSGRVTIQLVDEEAGVGAGRLQLFRGQSYEAIRAACLDSGILFRDPYFPAGPDALGY
DQLGPDSEKAKGVKWMRPHEFCAEPKFICEDMSRTDVCQGSLGNCWFLAAAASLTLYPRL
LRRVVPPGQDFQHGYAGVFHFQLWQFGRWMDVVVDDRLPVREGKLMFVRSEQRNEFWAPL
LEKAYAKLHGSYEVMRGGHMNEAFVDFTGGVGEVLYLRQNSMGLFSALRHALAKESLVGA
TALSDRGEYRTEEGLVKGHAYSITGTHKVFLGFTKVRLLRLRNPWGCVEWTGAWSDSCPR
WDTLPTECRDALLVKKEDGEFWMELRDFLLHFDTVQICSLSPEVLGPSPEGGGWHVHTFQ
GRWVRGFNSGGSQPNAETFWTNPQFRLTLLEPDEEDDEDEEGPWGGWGAAGARGPARGGR
TPKCTVLLSLIQRNRRRLRAKGLTYLTVGFHVFQIPEELLGLWDSPRSHALLPRLLRADR
SPLSARRDVTRRCCLRPGHYLVVPSTAHAGDEADFTLRVFSERRHTAVEIDDVISADLQS
LQGPYLPLELGLEQLFQELAGEEEELNASQLQALLSIALEPARAHTSTPREIGLRTCEQL
LQCFGHGQSLALHHFQQLWGYLLEWQAIFNKFDEDTSGTMNSYELRLALNAAGFHLNNQL
TQTLTSRYRDSRLRVDFERFVSCVAHLTCIFCHCSQHLDGGEGVICLTHRQWMEVATFS
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggcatccagcagtgggagggtcaccatccagctcgtggatgaggaggctggggtcgga
gccgggcgcctgcagctttttcggggccagagctatgaggcaattcgggcagcctgcctg
gattcggggatcctgttccgcgacccttacttccctgctggccctgatgcccttggctat
gaccagctggggccggactcggagaaggccaaaggcgtgaaatggatgaggccccatgag
ttctgtgctgagccgaagttcatctgtgaagacatgagccgcacagacgtgtgtcagggg
agcctgggtaactgctggttccttgcagctgccgcctcccttactctgtatccccggctc
ctgcgccgggtggtccctcctggacaggatttccagcatggctacgcaggcgtcttccac
ttccagctctggcagtttggccgctggatggacgtcgtggtggatgacaggctgcccgtg
cgtgaggggaagctgatgttcgtgcgctcggaacagcggaatgagttctgggccccactc
ctggagaaggcctacgccaagctccacggctcctatgaggtgatgcggggcggccacatg
aatgaggcttttgtggatttcacaggcggcgtgggcgaggtgctctatctgagacaaaac
agcatggggctgttctctgccctgcgccatgccctggccaaggagtccctcgtgggcgcc
actgccctgagtgatcggggtgagtaccgcacagaagagggcctggtaaagggacacgcg
tattccatcacgggcacacacaaggtgttcctgggcttcaccaaggtgcggctgctgcgg
ctgcggaacccatggggctgcgtggagtggacgggggcctggagcgacagctgcccacgc
tgggacacactccccaccgagtgccgcgatgccctgctggtgaaaaaggaggatggcgag
ttctggatggagctgcgggacttcctcctccatttcgacaccgtgcagatctgctcgctg
agcccggaggtgctgggccccagcccggaggggggcggctggcacgtccacaccttccaa
ggccgctgggtgcgtggcttcaactccggcgggagccagcctaatgctgaaaccttctgg
accaatcctcagttccgtttaacgctgctggagcctgatgaggaggatgacgaggatgag
gaagggccctgggggggctggggggctgcaggggcacggggcccagcgcgggggggccgc
acgcccaagtgcacggtccttctgtccctcatccagcgcaaccggcggcgcctgagagcc
aagggcctcacttacctcaccgttggcttccacgtgttccagattccagaggagctgctg
ggcctctgggattccccgcgcagccatgcgctcctgccccggctgctgcgcgccgaccgc
tcgcccctcagcgcccgccgcgacgtgacccgccgctgctgcctgcgtccaggccactac
ctggtggtgccgagcaccgcccacgccggcgacgaggctgacttcactctgcgtgtcttc
tccgagcgccgccacacggccgtggagatcgacgacgtgatcagcgcagacctgcagtct
ctccagggcccctacctgcccctggagctggggttggagcagctgtttcaggagctggct
ggagaggaggaagaactcaatgcctctcagctccaggccttactaagcattgccctggag
cctgccagggcccatacctccacccccagagagatcgggctcaggacctgtgagcagctg
ctgcagtgtttcgggcatgggcaaagcctggccttacaccacttccagcagctctggggc
tacctcctggagtggcaggccatatttaacaagttcgatgaggacacctctggaaccatg
aactcctacgagctgaggctggcactgaatgcagcaggcttccacctgaacaaccagctg
acccagaccctcaccagccgctaccgggatagccgtctgcgtgtggacttcgagcggttc
gtgtcctgtgtggcccacctcacctgcatcttctgccactgcagccagcacctggatggg
ggtgagggggtcatctgcctgacccacagacagtggatggaggtggccaccttctcctag

DBGET integrated database retrieval system