KEGG   Homo sapiens (human): 147991
Entry
147991            CDS       T01001                                 
Symbol
DPY19L3
Name
(RefSeq) dpy-19 like C-mannosyltransferase 3
  KO
K24553  C-mannosyltransferase DPY19L [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    147991 (DPY19L3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     147991 (DPY19L3)
Glycosyltransferases [BR:hsa01003]
 Others
  Other glycosyltransferases
   147991 (DPY19L3)
SSDB
Motif
Pfam: Dpy19 DUF6798
Other DBs
NCBI-GeneID: 147991
NCBI-ProteinID: NP_001166245
OMIM: 613894
HGNC: 27120
Ensembl: ENSG00000178904
Pharos: Q6ZPD9(Tdark)
UniProt: Q6ZPD9
Position
19:32405770..32485890
AA seq 716 aa
MMSIRQRREIRATEVSEDFPAQEENVKLENKLPSGCTSRRLWKILSLTIGGTIALCIGLL
TSVYLATLHENDLWFSNIKEVEREISFRTECGLYYSYYKQMLQAPTLVQGFHGLIYDNKT
ESMKTINLLQRMNIYQEVFLSILYRVLPIQKYLEPVYFYIYTLFGLQAIYVTALYITSWL
LSGTWLSGLLAAFWYVTNRIDTTRVEFTIPLRENWALPFFAIQIAAITYFLRPNLQPLSE
RLTLLAIFISTFLFSLTWQFNQFMMLMQALVLFTLDSLDMLPAVKATWLYGIQITSLLLV
CILQFFNSMILGSLLISFNLSVFIARKLQKNLKTGSFLNRLGKLLLHLFMVLCLTLFLNN
IIKKILNLKSDEHIFKFLKAKFGLGATRDFDANLYLCEEAFGLLPFNTFGRLSDTLLFYA
YIFVLSITVIVAFVVAFHNLSDSTNQQSVGKMEKGTVDLKPETAYNLIHTILFGFLALST
MRMKYLWTSHMCVFASFGLCSPEIWELLLKSVHLYNPKRICIMRYSVPILILLYLCYKFW
PGMMDELSELREFYDPDTVELMNWINSNTPRKAVFAGSMQLLAGVKLCTGRTLTNHPHYE
DSSLRERTRAVYQIYAKRAPEEVHALLRSFGTDYVILEDSICYERRHRRGCRLRDLLDIA
NGHMMDGPGENDPDLKPADHPRFCEEIKRNLPPYVAYFTRVFQNKTFHVYKLSRNK
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgatgtccatccggcaaagaagagaaataagagccacagaagtttctgaagactttcca
gcccaagaagaaaatgtgaagttggaaaataaattgccatctggttgtaccagtagaaga
ttatggaagattttgtcattgacaattggtggaaccattgccctttgcattggacttctt
acatctgtctaccttgccacgttacatgaaaatgatttatggttttctaatattaaggaa
gtggagcgagaaatctcattcagaacagagtgtggcctgtattactcctactacaagcag
atgctgcaggctccaaccctcgtgcaaggttttcatggcctaatatatgataataaaact
gaatctatgaagacaattaacctccttcagcgaatgaatatttaccaagaggtttttctc
agtattttatatagagttctacccatacagaaatatttagagccagtttatttttatatt
tacaccttatttgggctccaggcgatctatgtcacagctctctacataaccagctggcta
ctcagtggtacatggctgtcaggactgttggcagctttctggtatgtcacaaatagaata
gataccacaagagttgagtttaccatcccactgagggagaactgggcgctgccattcttt
gcaattcagatagcagcaattacatatttcctgagaccaaacttacagcctctttctgaa
aggctgacacttcttgccattttcatatcaacttttctctttagtctgacatggcaattt
aatcaatttatgatgctgatgcaagcattagtgctgttcacactggactccctggacatg
ctgccagcagtgaaggcgacatggctgtatggaatacagataacaagtttactcctggtc
tgcattcttcagttttttaattccatgattcttggatcactgcttatcagttttaacctt
tcagtattcattgcaagaaaacttcagaaaaatctgaaaactggaagcttccttaatagg
cttgggaaacttttgttacatttatttatggttttatgtttgacactttttctcaacaac
ataattaagaaaattcttaacctgaagtcagatgaacacatatttaaatttctgaaggca
aaatttgggcttggagcaacaagggattttgatgcaaatctctatctgtgtgaagaagct
tttggcctcctgccttttaatacatttggaaggctttcagatactctgcttttttatgct
tacatattcgttctgtccatcacagtgattgtagcattcgttgttgcctttcataatctc
agtgattctacaaatcaacaatccgtgggtaaaatggaaaaaggcacagttgacctgaaa
ccagaaactgcctacaacttaatacataccattctgtttggattcttggcattgagtaca
atgagaatgaagtacctctggacgtcacacatgtgtgtgttcgcatcattcggcctatgt
agccctgaaatatgggagttacttctgaagtcagtccatctttataacccaaagaggata
tgtataatgcgatattcagtaccgatattaatactgctgtatctatgctataagttctgg
ccaggaatgatggatgaactctccgagttgagagaattctatgatccagatacagtggag
ctgatgaactggattaactctaacactccaagaaaggctgtgtttgcgggaagcatgcag
ttgctggccggagtcaagctgtgcacgggaaggaccctaaccaaccacccgcactatgaa
gacagcagcctgagagagcggaccagagcggtttatcagatatatgccaagagggcacca
gaggaagtgcatgccctcctaaggtccttcggcactgactacgtaatcctggaagacagc
atctgctacgagcggaggcaccgccggggctgccgactccgggacctgctggacattgcc
aacggccacatgatggatggcccaggagagaatgatcctgatttgaaacctgcagaccac
cctcgcttctgtgaagagatcaaaagaaacctgcctccctacgtggcctacttcaccaga
gtgttccagaacaaaaccttccacgtttacaagctgtccagaaacaagtag

DBGET integrated database retrieval system