KEGG   Homo sapiens (human): 148022Help
Entry
148022            CDS       T01001                                 

Gene name
TICAM1, IIAE6, MyD88-3, PRVTIRB, TICAM-1, TRIF
Definition
(RefSeq) toll like receptor adaptor molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa05133  Pertussis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
Network
N00148  TLR3-IRF7 signaling pathway
N00149  TLR3-IRF3 signaling pathway
N00271  HCV NS3 to host-cell-protein inhibition
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    148022 (TICAM1)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    148022 (TICAM1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    148022 (TICAM1)
   04621 NOD-like receptor signaling pathway
    148022 (TICAM1)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    148022 (TICAM1)
   05164 Influenza A
    148022 (TICAM1)
   05161 Hepatitis B
    148022 (TICAM1)
   05160 Hepatitis C
    148022 (TICAM1)
   05168 Herpes simplex infection
    148022 (TICAM1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    148022 (TICAM1)
   05165 Human papillomavirus infection
    148022 (TICAM1)
   05142 Chagas disease (American trypanosomiasis)
    148022 (TICAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHIM TIR_2
Motif
Other DBs
NCBI-GeneID: 148022
NCBI-ProteinID: NP_891549
OMIM: 607601
HGNC: 18348
Ensembl: ENSG00000127666
Vega: OTTHUMG00000180248
Pharos: Q8IUC6(Tbio)
UniProt: Q8IUC6
Structure
PDB: 

Position
19p13.3
AA seq 712 aa AA seqDB search
MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARIS
LEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQE
AVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRSLPR
PIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLSLHRSPHGPSKLCDDPQASLVP
EPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAPDATSTGLPDTPAAPETSTNY
PVECTEGSAGPQSLPLPILEPVKNPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPETSP
PPPPPPPSSTPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALG
VPDGATFCEDFQVPGRGELSCLQDAIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQ
GSPDCVIPFLPLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMW
RKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTG
APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQS
PAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcacaggcccatcacttcctagcgccttcgacattctaggtgcagcaggccag
gacaagctcttgtatctgaagcacaaactgaagaccccacgcccaggctgccaggggcag
gacctcctgcatgccatggttctcctgaagctgggccaggaaactgaggccaggatctct
ctagaggcattgaaggccgatgcggtggcccggctggtggcccgccagtgggctggcgtg
gacagcaccgaggacccagaggagcccccagatgtgtcctgggctgtggcccgcttgtac
cacctgctggctgaggagaagctgtgccccgcctcgctgcgggacgtggcctaccaggaa
gccgtccgcaccctcagctccagggacgaccaccggctgggggaacttcaggatgaggcc
cgaaaccggtgtgggtgggacattgctggggatccagggagcatccggacgctccagtcc
aatctgggctgcctcccaccatcctcggctttgccctctgggaccaggagcctcccacgc
cccattgacggtgtttcggactggagccaagggtgctccctgcgatccactggcagccct
gcctccctggccagcaacttggaaatcagccagtcccctaccatgcccttcctcagcctg
caccgcagcccacatgggcccagcaagctctgtgacgacccccaggccagcttggtgccc
gagcctgtccccggtggctgccaggagcctgaggagatgagctggccgccatcgggggag
attgccagcccaccagagctgccaagcagcccacctcctgggcttcccgaagtggcccca
gatgcaacctccactggcctccctgatacccccgcagctccagaaaccagcaccaactac
ccagtggagtgcaccgaggggtctgcaggcccccagtctctccccttgcctattctggag
ccggtcaaaaacccctgctctgtcaaagaccagacgccactccaactttctgtagaagat
accacctctccaaataccaagccgtgcccacctactcccaccaccccagaaacatcccct
cctcctcctcctcctcctccttcatctactccttgttcagctcacctgaccccctcctcc
ctgttcccttcctccctggaatcatcatcggaacagaaattctataactttgtgatcctc
cacgccagggcagacgaacacatcgccctgcgggttcgggagaagctggaggcccttggc
gtgcccgacggggccaccttctgcgaggatttccaggtgccggggcgcggggagctgagc
tgcctgcaggacgccatagaccactcagctttcatcatcctacttctcacctccaacttc
gactgtcgcctgagcctgcaccaggtgaaccaagccatgatgagcaacctcacgcgacag
gggtcgccagactgtgtcatccccttcctgcccctggagagctccccggcccagctcagc
tccgacacggccagcctgctctccgggctggtgcggctggacgaacactcccagatcttc
gccaggaaggtggccaacaccttcaagccccacaggcttcaggcccgaaaggccatgtgg
aggaaggaacaggacacccgagccctgcgggaacagagccaacacctggacggtgagcgg
atgcaggcggcggcactgaacgcagcctactcagcctacctccagagctacttgtcctac
caggcacagatggagcagctccaggtggcttttgggagccacatgtcatttgggactggg
gcgccctatggggctcgaatgccctttgggggccaggtgcccctgggagccccgccaccc
tttcccacttggccggggtgcccgcagccgccacccctgcacgcatggcaggctggcacc
cccccaccgccctccccacagccagcagcctttccacagtcactgcccttcccgcagtcc
ccagccttccctacggcctcacccgcaccccctcagagcccagggctgcaacccctcatt
atccaccacgcacagatggtacagctggggctgaacaaccacatgtggaaccagagaggg
tcccaggcgcccgaggacaagacgcaggaggcagaatga

DBGET integrated database retrieval system