KEGG   Homo sapiens (human): 148137
Entry
148137            CDS       T01001                                 
Symbol
PROSER3, C19orf55
Name
(RefSeq) proline and serine rich 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ada3
Other DBs
NCBI-GeneID: 148137
NCBI-ProteinID: NP_001034976
HGNC: 25204
Ensembl: ENSG00000167595
Vega: OTTHUMG00000168103
Pharos: Q2NL68(Tdark)
UniProt: Q2NL68
Position
19:35758176..35771166
AA seq 480 aa
MDRSLPVFSIQDSPFGDAPLGRSHYWPSQSQTWCPKTLSPSRSQRSRLPQAPKALATGPN
SPELFEESWPSSSGTPSLPSTTEGQMWASPAPTLIDSGDSVVAKYINRFRQAQPTSREER
QPAGPTPADFWWLQSDSPDPSSQSAAAGANKPEGRPHTAVPTAVNVTSASHAVAPLQEIK
QNLHTWNSSLLDLETLSLQSRAARLLKRSKASISSSSSLSPSDASTSSFPTSSDGLSPFS
ETFIPDSSKGLGPRAPASPAPAQAQTPTPAPAPASSQAPLRPEDDILYQWRQRRKLEQAQ
GSKGDRAWVPPLTPALRTLAESLKAKALPPAAGSVIRKSEATPSPGACLQPEVPLSPAEQ
ATTVKASPPAFQVGSPEALAPPPPAADHAPSEALLAQAALLLQAAEDSDGSEFQDDPVLQ
VLRAHRAELSRQKREADARLSFLLDQAEDLGSWSPPAGSPPRSPRRLLRREGDSLEARRL
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggaccgcagcctgccagttttctccattcaagatagtccctttggagatgcgcccctg
ggtcgaagccactactggccatcccagagccagacctggtgtcccaagaccctgagccca
tccaggtctcagagatccaggctcccacaagctcccaaggctctagccacaggtcccaac
tcccctgagctgtttgaggagtcctggccatccagttcagggaccccctccctgcccagc
accactgagggacagatgtgggcctccccagcacccaccctgattgacagcggggactcc
gtggtggccaagtatataaacaggttccgccaggctcagcccaccagtcgagaggagcgc
cagcctgcaggcccaaccccagctgacttttggtggctgcagtctgactctccagacccc
agcagtcaaagtgcagcagcaggagccaacaaaccagaaggaagaccccatacagctgtc
cctactgcggtcaacgtgaccagtgcatcccatgctgtggctccccttcaggaaataaag
cagaacctccacacatggaactcatccctgctggacctggagacgctgagcctacagagc
agagctgccaggctgctcaaacgcagcaaagcctccatctcctcctcctcctccctcagc
cccagcgatgccagcacttcctcattccccaccagctctgatggcctctctcccttctcg
gagaccttcatccctgactccagcaagggccttggccccagggcacccgcatccccggca
ccagcccaggcccagacccccacccctgctccagccccagcctcctcccaagcacccctt
cggccagaggatgacattctgtaccagtggcggcagcggcggaagcttgaacaggctcag
ggaagcaagggtgacagagcttgggtgccgcctctgacccctgccctccgcacgttggcc
gagtctctgaaagccaaggccttgccgcccgcagcggggtcagtgatacggaagagcgaa
gccactccttcccctggagcctgcctgcagcccgaggtcccactctctccagctgagcag
gcaaccacagtcaaggcctcgccgccagccttccaggtggggtctccggaggccctggcc
ccgcccccgcccgctgctgaccacgccccctcggaggccctgcttgcccaggccgccctg
ctgctgcaggctgcagaagactccgacggcagcgagttccaggacgatcccgtgctgcag
gtgctaagagcccatagggcagagctgagtcggcagaaaagggaagcggatgcccgatta
tcgttcctgttggaccaggctgaagacctgggatcttggtcccctccagccgggtcgccc
cctaggtccccaaggaggctgctaagaagggaaggagattccctggaggccagaagactt
tga

DBGET integrated database retrieval system